Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1M1 Olfactory Receptor

Gene Symbol OR1M11 (View this gene in GeneCards)
Family 1
Subfamily M
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR19-5, OR19-6, HsOR19.2.3, ORL3389
External Ids HGNC: 8220   GeneBank: AB065925, AF399549, BK004269, NM_001004456   ORDB: ORL3389   
Build #39 labels OR1M1
Chromosomal location 19:9,093,245-9,094,183 (+)
Cluster 19@9b
Synteny CLIC#42
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1E1 55.48% 310
OR1F12 55.05% 307
OR1N1 56.31% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1M1B 88% 313
Chimp CONTIG904.61-2336 57% 311
Chimp CONTIG*********** 56% 309
Chimp CONTIG1419.27-1053 55% 308
Mouse Or1m1 85% 313
Rat Or1m1 86% 313
Cow OR1M1 85% 313

Expression evidences

Source Accession
mRNA AB529309
GNF Atlas2 gnf1h11121_at

Sequence information

Nucleotide sequence ATGGAACCAAGAAACCAAACCAGTGCATCTCAATTCATCCTCCTGGGACTCTCAGAAAAG
CCAGAGCAGGAGACGCTTCTCTTTTCCCTGTTCTTCTGCATGTACCTGGTCATGGTCGTG
GGGAACCTGCTCATCATCCTGGCCATCAGCATAGACTCCCACCTCCACACCCCCATGTAC
TTCTTCCTGGCCAACCTGTCCCTGGTTGATTTCTGTCTGGCCACCAACACCATCCCTAAG
ATGCTGGTGAGCCTTCAAACCGGGAGCAAGGCCATCTCTTATCCCTGCTGCCTGATCCAG
ATGTACTTCTTCCATTTCTTTGGCATCGTGGACAGCGTCATAATCGCCATGATGGCTTAT
GACCGGTTCGTGGCCATCTGCCACCCATTGCACTACGCCAAGATCATGAGCCTACGCCTC
TGTCGCCTGCTGGTCGGCGCCCTCTGGGCGTTTTCCTGCTTCATCTCACTCACTCACATC
CTCCTGATGGCCCGTCTCGTTTTCTGCGGCAGCCATGAGGTGCCTCACTACTTCTGCGAC
CTCACTCCCATCCTCCGACTTTCGTGCACGGACACCTCTGTGAATAGGATCTTCATCCTC
ATTGTGGCAGGGATGGTGATAGCCACGCCCTTTGTCTGCATCCTGGCCTCCTATGCTCGC
ATCCTTGTGGCCATCATGAAGGTCCCCTCTGCAGGCGGCAGGAAGAAAGCCTTCTCCACC
TGCAGCTCCCACCTGTCTGTGGTTGCTCTCTTCTATGGGACCACCATTGGCGTCTATCTG
TGTCCCTCCTCGGTCCTCACCACTGTGAAGGAGAAAGCTTCTGCGGTGATGTACACAGCA
GTCACCCCCATGCTGAATCCCTTCATCTACAGCTTGAGGAACAGAGACCTGAAAGGGGCT
CTCAGGAAGCTGGTCAACAGAAAGATCACCTCATCTTCC
Conceptual translation MEPRNQTSASQFILLGLSEKPEQETLLFSLFFCMYLVMVVGNLLIILAISIDSHLHTPMY
FFLANLSLVDFCLATNTIPKMLVSLQTGSKAISYPCCLIQMYFFHFFGIVDSVIIAMMAY
DRFVAICHPLHYAKIMSLRLCRLLVGALWAFSCFISLTHILLMARLVFCGSHEVPHYFCD
LTPILRLSCTDTSVNRIFILIVAGMVIATPFVCILASYARILVAIMKVPSAGGRKKAFST
CSSHLSVVALFYGTTIGVYLCPSSVLTTVKEKASAVMYTAVTPMLNPFIYSLRNRDLKGA
LRKLVNRKITSSS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 9,203,994 9,203,994 NS C/T T/M rs61738474 (DbSNP)
19 9,204,307 9,204,307 SYN A/G P/P rs4804097 (DbSNP)
19 9,204,358 9,204,358 SYN C/T G/G rs7259007 (DbSNP)
19 9,093,631 9,093,631 SYN A/G P/P 1000GP (CEU, CHBJPT)
19 100 -100 NS C/T T/M 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
19 100 -100 SYN C/T T/T 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 198 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T28M V43M A94T V113M V127M V170I T193M L248V % Freq CORP
1 T V A V V V T L 95.24 0.158
2 M V A V V V T L 1.77 0.158
3 T V T V V I T L 1.54 0.158
4 T V A M V V T L 0.61 0.158
5 T M A V V V T V 0.38 0.093
6 T V A V M V T L 0.23 0.158
7 T V A V V V M L 0.15 0.158
8 T V A V V I T L 0.08 0.158

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1M1.aApr07-unspliced main_exon CDS chr19 9,093,245 9,094,183 +
3UTR chr19 9,094,183 9,094,186 +