Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1N2 Olfactory Receptor

Gene Symbol OR1N21 (View this gene in GeneCards)
Family 1
Subfamily N
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR9-23, HsOR9.6.5, ORL3246
External Ids HGNC: 15111   GeneBank: AB065720, AF399536, BK004445, NM_001004457   ORDB: ORL3246   
Build #39 labels OR1N2
Chromosomal location 9:122,553,212-122,554,159 (+)
Cluster 9@125
Synteny CLIC#21
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1E1 56.82% 308
OR1F1 56.49% 308
OR1N1 60.13% 301

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1D6 60% 303
Mouse Or1n2 88% 316
Rat Or1n2 87% 316
Cow OR1F1 59% 311
Orang OR1N17P 62% 302
Horse OR1N2B 88% 316
Chimp OR1N1 60% 301

Expression evidences

Source Accession
mRNA AB529310
GNF Atlas2 gnf1h10673_at

Sequence information

Nucleotide sequence ATGGGAAAACCAGGCAGAGTGAACCAAACCACTGTTTCAGACTTCCTCCTTCTAGGACTC
TCTGAGTGGCCAGAGGAGCAGCCTCTTCTGTTTGGCATCTTCCTTGGCATGTACCTGGTC
ACCATGGTGGGGAACCTGCTCATTATCCTGGCCATCAGCTCTGACCCACACCTCCATACT
CCCATGTACTTCTTTCTGGCCAACCTGTCATTAACTGATGCCTGTTTCACTTCTGCCTCC
ATCCCCAAAATGCTGGCCAACATTCATACCCAGAGTCAGATCATCTCGTATTCTGGGTGT
CTTGCACAGCTATATTTCCTCCTTATGTTTGGTGGCCTTGACAACTGCCTGCTGGCTGTG
ATGGCATATGACCGCTATGTGGCCATCTGCCAACCACTCCATTACAGCACATCTATGAGT
CCCCAGCTCTGTGCACTAATGCTGGGTGTGTGCTGGGTGCTAACCAACTGTCCTGCCCTG
ATGCACACACTGTTGCTGACCCGCGTGGCTTTCTGTGCCCAGAAAGCCATCCCTCATTTC
TATTGTGATCCTAGTGCTCTCCTGAAGCTTGCCTGCTCAGATACCCATGTAAACGAGCTG
ATGATCATCACCATGGGCTTGCTGTTCCTCACTGTTCCCCTCCTGCTGATCGTCTTCTCC
TATGTCCGCATTTTCTGGGCTGTGTTTGTCATCTCATCTCCTGGAGGGAGATGGAAGGCC
TTCTCTACCTGTGGTTCTCATCTCACGGTGGTTCTGCTCTTCTATGGGTCTCTTATGGGT
GTGTATTTACTTCCTCCATCAACTTACTCTACAGAGAGGGAAAGTAGGGCTGCTGTTCTC
TATATGGTGATTATTCCCACGCTAAACCCATTCATTTATAGCTTGAGGAACAGAGACATG
AAGGAGGCTTTGGGTAAACTTTTTGTCAGTGGAAAAACATTCTTTTTA
Conceptual translation MGKPGRVNQTTVSDFLLLGLSEWPEEQPLLFGIFLGMYLVTMVGNLLIILAISSDPHLHT
PMYFFLANLSLTDACFTSASIPKMLANIHTQSQIISYSGCLAQLYFLLMFGGLDNCLLAV
MAYDRYVAICQPLHYSTSMSPQLCALMLGVCWVLTNCPALMHTLLLTRVAFCAQKAIPHF
YCDPSALLKLACSDTHVNELMIITMGLLFLTVPLLLIVFSYVRIFWAVFVISSPGGRWKA
FSTCGSHLTVVLLFYGSLMGVYLLPPSTYSTERESRAAVLYMVIIPTLNPFIYSLRNRDM
KEALGKLFVSGKTFFL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 NS T/C W/R 1000GP (YRI, YRI, YRI, YRI, YRI)
9 100 -100 SYN C/T L/L 1000GP (YRI, YRI, YRI, YRI)
9 122,553,263 122,553,263 SYN C/T L/L 1000GP (CEU, CHBJPT)
9 122,553,278 122,553,278 NS T/C W/R 1000GP (CEU, CHBJPT)
9 122,553,499 122,553,499 SYN G/C S/S 1000GP (CEU, CHBJPT)
9 122,553,749 122,553,749 NS T/C F/L 1000GP (CEU)
9 122,553,754 122,553,754 SYN T/C Y/Y 1000GP (CEU, CHBJPT)
9 122,553,763 122,553,763 SYN T/C P/P 1000GP (CEU, CHBJPT)
9 122,553,878 122,553,878 NS C/T R/C 1000GP (CEU, CHBJPT)
9 122,553,900 122,553,900 NS T/G V/G 1000GP (CEU)
9 122,553,961 122,553,961 SYN G/A V/V 1000GP (CEU)
9 122,554,071 122,554,071 NS C/T T/M 1000GP (CEU, CHBJPT)
9 125,315,542 125,315,542 SYN C/T L/L rs1831369 (DbSNP)
9 125,315,557 125,315,557 NS C/T R/W rs1831370 (DbSNP)
9 125,315,778 125,315,778 SYN C/G S/S rs1411271 (DbSNP)
9 125,316,028 125,316,028 NS C/T L/F rs41297203 (DbSNP)
9 125,316,033 125,316,033 SYN C/T Y/Y rs1341042 (DbSNP)
9 125,316,042 125,316,042 SYN C/T P/P rs1341043 (DbSNP)
9 125,316,157 125,316,157 NS C/T R/C rs41316976 (DbSNP)
9 125,316,179 125,316,179 NS G/T G/V rs1341044 (DbSNP)
9 125,316,218 125,316,217 Ins(1) -/G rs35880826 (DbSNP)
9 125,316,240 125,316,240 SYN A/G V/V rs71511510 (DbSNP)
9 125,316,350 125,316,350 NS C/T T/M rs1411272 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
9 125,313,731 125,319,766 CopyNumber Variation_70789 (DGV)
9 125,315,391 125,318,438 CopyNumber #48 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

W37R R139C F194L R237C V244G T301M % Freq CORP
1 R R F R G M 51.84 0.371
2 W R F R V T 17.97 0.371
3 W R F C G T 11.29 0.327
4 W R F R G T 7.53 0.371
5 W R L R G T 5.84 0.371
6 W R F R G M 3.69 0.371
7 R C F R G M 1.15 0.371
8 R R F R G T 0.23 0.371
9 R R F R V M 0.15 0.371
10 W C F R G T 0.15 0.371
11 R R L R G T 0.08 0.371
12 W R L R V T 0.08 0.371

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1N2.aApr07-unspliced main_exon 5UTR chr9 122,553,170 122,553,212 +
CDS chr9 122,553,212 122,554,159 +
3UTR chr9 122,554,159 122,554,162 +