Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1R1P Olfactory Receptor

Gene Symbol OR1R1P1 (View this gene in GeneCards)
Family 1
Subfamily R
Pseudogene Yes
CORP pseudogene probability score
Aliases OR17-1, OR17-21, HsOR17.1.13, ORL3750
External Ids HGNC: 8226   GeneBank: AB065573, AF087915, BK004550, NG_002302   ORDB: ORL3750   
Build #39 labels OR1R2P, OR1R3P, OR1R1P
Chromosomal location 17:3,385,930-3,386,871 (+)
Cluster 17@3b
Synteny CLIC#39
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1F1 44.92% 305
OR1L4 45.15% 299
OR1L6 46.15% 299

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1R1 80% 315
Mouse Or1r1 83% 315
Rat Or1r1 80% 315
Cow OR1R1 84% 313
Orang OR1L6 46% 299
Horse OR1AF1 48% 304
Chimp OR1F1P 46% 305

Expression evidences

Source Accession
ESTs DA732634
GNF Atlas2 gnf1h10742_at

Sequence information

Nucleotide sequence ATGGCTCCGACCAACCTCACATCTGCCCCCGTGTTCCTCCTCCTCGGCCTGGTGGACGGA
ACAGACGCCCACCCGCTGCTGTTCCTGCTCTGCCTTGGCATCTATCTGCTCAACGCCCTG
AGCAACCTGAGCATGGTGGCGCTGGTGAGATCCGACGGGGCCCTCCGCTCCCCCATGTAT
TACTTCTTGGGTCACCTGAGCCTCGTGGACGTCTGCTTTACCACCGTCACGGTCCCCAGG
CTGCTGGCCGGCCTGCTCCACCCGGGCCAGGCCATATCCTTCCAGGCGTGCTTTGCCGAG
ATGTACTTCTTCGTGGCTCTGGGCATCACCGAGAGCTACCTCCTGGCGGCCATGTCCTAC
GACCGCCCGACGGCGGCGTGCCGGCCCCTGCGCTACGGCGCGCTGGTGACGCCATGGCGC
TGCGCCTCGCTGGTGCGTGCGTCGTGGGCCGTGACGCACCTGCACTCGCTGCTGCACACG
CTGCTCCTCTCCGCGCTCTCCTACCCCTACCCCACCCCCGTGCGCCCCTTCTTTTGCGAC
ATGACGGTGATGCTGAGCTTGGCGACCTCGGACACGTCCGCCGCGGAGACGGCCATCTTC
TCCGAGGGCCTGGCCGTGGTGTTGGCCCCGCTGCTCCTCGTGTTCCTTTTCCTACGCGCG
CATCCTGGTCGCGGTGCTCGGCTTGCCGGCGGCCGGCGCCGCGCCTTCTCCACCTGCGGG
GCCCACCTAGTGGCGGTGGCGGTGGCGCTTTTCTTTGGCTCTGTCCTCTCCGTGTATTTC
CCGCCGTCGTCTGCCTACTCAGCCCGCTACGACCGCCTGGCCAGCGTGGTCTACGCTGTC
ATCACGCCGACCTTGAACCCTTTCATCAACAGCCTTCGCAACAAAGAGGTCAAGGGCGCC
CTGAAAAGGGGGCTCAGATGGAGGGCTGCACCCCAAGAGGCG
Conceptual translation MAPTNLTSAPVFLLLGLVDGTDAHPLLFLLCLGIYLLNALSNLSMVALVRSDGALRSPMY
YFLGHLSLVDVCFTTVTVPRLLAGLLHPGQAISFQACFAEMYFFVALGITESYLLAAMSY
DRPTAACRPLRYGALVTPWRCASLVRASWAVTHLHSLLHTLLLSALSYPYPTPVRPFFCD
MTVMLSLATSDTSAAETAIFSEGLAVVLAPLLLVFL\YARILVAVLGLP\P\RAFST
CGAHLVAVAVALFFGSVLSVYFPPSSAYSARYDRLASVVYAVITPTLNPFINSLRNKEVK
GALKRGLRWRAAPQEA

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
17 3,289,912 3,289,912 Del(1) -/G rs34179555 (DbSNP)
17 3,289,291 3,289,290 Ins(4) -/AGAC rs72149113 (DbSNP)
17 3,289,290 3,289,289 Ins(4) -/AGAC rs34476178 (DbSNP)
17 3,289,284 3,289,283 Ins(4) -/CTGT rs3833164 (DbSNP)
17 3,289,962 3,289,961 Ins(6) -/GGCGGT rs72061668 (DbSNP)
17 3,289,971 3,289,970 Ins(6) -/GTGGCG rs56743096 (DbSNP)
17 3,289,547 3,289,547 SNP A/C rs61735160 (DbSNP)
17 3,289,815 3,289,815 SNP A/G rs61734055 (DbSNP)
17 3,289,661 3,289,661 SNP A/T rs61734058 (DbSNP)
17 3,289,914 3,289,914 SNP C/G rs8064456 (DbSNP)
17 3,289,590 3,289,590 SNP C/G rs2931819 (DbSNP)
17 3,289,911 3,289,911 SNP C/G rs2956855 (DbSNP)
17 3,289,910 3,289,910 SNP C/G rs2956856 (DbSNP)
17 3,289,567 3,289,567 SNP C/T rs227979 (DbSNP)
17 3,289,595 3,289,595 SNP G/T rs61734059 (DbSNP)
17 3,289,376 3,289,376 SNP T/C rs227980 (DbSNP)
17 3,386,082 3,386,082 SNP C/T 1000GP (CEU, CHBJPT)
17 3,386,273 3,386,273 SNP T/C 1000GP (CEU, CHBJPT)
17 3,386,296 3,386,296 SNP C/G 1000GP (CEU, CHBJPT)
17 3,386,666 3,386,666 SNP T/G 1000GP (CHBJPT)
17 100 -100 SNP C/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 39 (Hasin)
17 3,289,124 3,292,165 Deletion #307 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.