Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1S1 Olfactory Receptor

Gene Symbol OR1S11 (View this gene in GeneCards)
Family 1
Subfamily S
Pseudogene No
CORP pseudogene probability score
Aliases OR11-232, OST034, HsOR11.12.10, ORL3315
External Ids HGNC: 8227   GeneBank: AB065493, BK004299, NM_001004458   ORDB: ORL3315   
Build #39 labels OR1S1
Chromosomal location 11:58,214,784-58,215,719 (+)
Cluster 11@58
Synteny CLIC#27
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs1966834)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1S2 91.67% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1S1P 81% 312
Chimp CONTIG229.242-50856 98% 312
Mouse Or1s2 81% 308
Rat Or1s2 78% 308
Cow OR1S7 75% 308

Expression evidences

Source Accession
GNF Atlas2 gnf1h05452_s_at

Sequence information

Nucleotide sequence ATGCATCAAGGAAACCAAACCACCATCACTGAATTCATTCTCCTGGGATTTTTCAAGCAG
GATGAGCATCAAAACCTCCTCTTTGTGCTTTTCTTGGGTATGTACCTGGTCACTGTGATT
GGGAACGGGCTCATCATTGTGGCTATCAGCTTGGATACGTACCTTCATACCCCCATGTAT
CTCTTCCTTGCCAATCTATCCTTTGCTGATATTTCCTCCATTTCCAACTCAGTCCCCAAA
ATGCTGGTGAATATTCAAACCAAGAGTCAATCCATCTCTTATGAGAGCTGCATCACACAG
ATGTACTTTTCTATTGTGTTTGTCGTCATTGACAATTTGCTCTTGGGGACCATGGCCTAT
GACCACTTTGTGGCGATCTGCCACCCTCTGAATTATACAATTCTCATGCGGCCCAGGTTC
GGCATTTTGCTCACAGTCATCTCATGGTTCCTCAGTAATATTATTGCTCTGACACACACC
CTTCTGCTCATTCAATTGCTCTTCTGTAACCACAACACTCTCCCACACTTCTTCTGTGAC
TTGGCCCCTCTGCTCAAACTGTCCTGTTCAGATACATTGATCAATGAGCTTGTGTTGTTT
ATTGTGGGTTTATCAGTTATCATCTTCCCCTTTACACTCAGCTTCTTTTCCTATGTCTGC
ATCATCAGAGCTGTCCTGAGAGTATCTTCCACACAGGGAAAGTGGAAAGCCTTCTCCACT
TGTGGCTCTCACCTGACAGTTGTATTACTGTTCTACGGAACCATTGTAGGCGTGTACTTT
TTCCCCTCCTCCACTCACCCTGAGGACACTGATAAGATTGGTGCTGTCCTATTCACTGTG
GTGACACCCATGATAAACCCCTTCATCTACAGCTTGAGGAATAAGGATATGAAAGGTGCC
CTGAGAAAGCTCATCAATAGAAAAATTTCTTCCCTT
Conceptual translation MHQGNQTTITEFILLGFFKQDEHQNLLFVLFLGMYLVTVIGNGLIIVAISLDTYLHTPMY
LFLANLSFADISSISNSVPKMLVNIQTKSQSISYESCITQMYFSIVFVVIDNLLLGTMAY
DHFVAICHPLNYTILMRPRFGILLTVISWFLSNIIALTHTLLLIQLLFCNHNTLPHFFCD
LAPLLKLSCSDTLINELVLFIVGLSVIIFPFTLSFFSYVCIIRAVLRVSSTQGKWKAFST
CGSHLTVVLLFYGTIVGVYFFPSSTHPEDTDKIGAVLFTVVTPMINPFIYSLRNKDMKGA
LRKLINRKISSL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS A/G Q/R 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN G/T L/L 1000GP (YRI)
11 57,982,584 57,982,584 NS T/C I/T rs1966835 (DbSNP)
11 57,982,620 57,982,620 NS G/A R/H rs1966834 (DbSNP)
11 57,982,726 57,982,726 SYN T/G L/L rs1993089 (DbSNP)
11 57,982,750 57,982,750 SYN A/G Q/Q rs61746527 (DbSNP)
11 57,982,763 57,982,763 NS G/A D/N rs1993088 (DbSNP)
11 57,982,832 57,982,832 NS A/T M/L rs2867400 (DbSNP)
11 57,982,896 57,982,896 NS T/G I/S rs2903566 (DbSNP)
11 57,983,162 57,983,162 NS A/G K/E rs7103026 (DbSNP)
11 58,215,112 58,215,112 NS T/C I/T 1000GP (CEU)
11 58,215,148 58,215,148 NS A/G H/R 1000GP (CEU, CHBJPT)
11 58,215,204 58,215,204 NS G/A G/S 1000GP (CEU)
11 58,215,254 58,215,254 SYN G/T L/L 1000GP (CEU)
11 58,215,291 58,215,291 NS A/G N/D 1000GP (CEU, CHBJPT)
11 58,215,360 58,215,360 NS T/A L/M 1000GP (CEU)
11 58,215,424 58,215,424 NS G/T S/I 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 210 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Q103R I123T H135R C140Y G154S N183D S227I % Freq CORP
1 Q I H C G N S 49.16 0.497
2 Q T R C G D I 45.08 0.497
3 Q T R C G N I 3.99 0.497
4 Q I H Y G N S 0.69 0.497
5 R I H C G N S 0.46 0.497
6 Q T H C G N S 0.23 0.497
7 Q I H C G N I 0.23 0.497
8 Q T R C G D S 0.08 0.497
9 Q T R C S D I 0.08 0.497

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1S1.aApr07-unspliced main_exon 5UTR chr11 58,214,745 58,214,784 +
CDS chr11 58,214,784 58,215,719 +
3UTR chr11 58,215,719 58,215,722 +