Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1S2 Olfactory Receptor

Gene Symbol OR1S21 (View this gene in GeneCards)
Family 1
Subfamily S
Pseudogene No
CORP pseudogene probability score 0.72 (pseudogene)
Aliases OR11-231, HsOR11.12.9, ORL3309
External Ids HGNC: 15141   GeneBank: AB065736, AF399557, BK004297, NM_001004459   ORDB: ORL3309   
Build #39 labels OR1S2
Chromosomal location 11:58,203,207-58,204,142 (-)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1S1 91.67% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1S1P 79% 312
Chimp CONTIG229.242-39283 98% 312
Mouse Or1s2 81% 308
Rat Or1s2 77% 307
Cow OR1S7 73% 308

Sequence information

Nucleotide sequence ATGCATCAAGAAAACCAAACCACCATCACTGAATTCATTCTCCTGGGACTCTCCAACCAG
GCTGAACATCAAAACCTCCTCTTTGTGCTTTTCCTGAGTATGTATGTGGTCACTGTGGTT
GGGAACGGGCTCATCATTGTGGCTATCAGCTTGGATATATACCTTCACACCCCCATGTAT
CTCTTCCTTGCCTACCTATCCTTTGCTGATATTTCCTCCATTTCCAACTCAGTCCCCAAA
ATGCTGGTGAATATTCAAACCAACAGCCAATCCATCTCTTATGAGAGCTGCATCACACAG
ATGTACTTTTCTATTGTGTTTGTCGTCACTGACAATTTGCTTTTGGGGACCATGGCCTTC
GACCACTTTGTGGCGATCTGCCACCCTCTGAACTATACAACTTTCATGCGGGCCAGGTTC
GGCACTTTGCTCACAGTCATCTCGTGGTTCCTCAGTAATATTATTGCTCTTACACACACC
CTTCTGCTCATTCAATTGCTCTTCTGTGACCACAACACTCTCCCACACTTCTTCTGTGAC
TTGGCCCCTCTGCTCAAACTGTCCTGTTCAGATACAATGATCAATGAGCTTGTGTTGTTT
ATTGTGGGTTTATCAGTTATCATCTTCCCCTTTGTACTCATCTTCTTCTCCTATGTCTGC
ATCATCAGAGCTGTCCTGGGAGTATCATCCACACAGGGAAAGTGGAAAGCCTTCTCCACT
TGTGGCTCTCACCTGACAATTGCATTACTGTTCTACGGAACCACTGTAGGCGTGTACTTT
TTCCCCTCCTCCACTCACCCTGAGGACACTGATAAGATTGGTGCTGTCCTATTCACTGTG
GTGACACCCATGATGAACCCCTTCATCTACAGCTTGAGGAATAAGGATATGAAAGGTGCC
CTGAGAAAGCTCATCAATAGAAAAATTTCTTCCCTT
Conceptual translation MHQENQTTITEFILLGLSNQAEHQNLLFVLFLSMYVVTVVGNGLIIVAISLDIYLHTPMY
LFLAYLSFADISSISNSVPKMLVNIQTNSQSISYESCITQMYFSIVFVVTDNLLLGTMAF
DHFVAICHPLNYTTFMRARFGTLLTVISWFLSNIIALTHTLLLIQLLFCDHNTLPHFFCD
LAPLLKLSCSDTMINELVLFIVGLSVIIFPFVLIFFSYVCIIRAVLGVSSTQGKWKAFST
CGSHLTIALLFYGTTVGVYFFPSSTHPEDTDKIGAVLFTVVTPMMNPFIYSLRNKDMKGA
LRKLINRKISSL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS A/G I/T 1000GP (YRI)
11 100 -100 SYN G/A F/F 1000GP (YRI, YRI)
11 57,970,980 57,970,980 NS A/G V/A rs11229277 (DbSNP)
11 57,970,980 57,970,981 mnp AC/GT rs34249289 (DbSNP)
11 57,970,981 57,970,981 NS C/T V/I rs11229278 (DbSNP)
11 57,971,195 57,971,195 SYN A/G F/F rs11229279 (DbSNP)
11 57,971,201 57,971,201 SYN A/G A/A rs11229280 (DbSNP)
11 57,971,478 57,971,478 NS A/G I/T rs11229281 (DbSNP)
11 58,203,508 58,203,508 NS A/G V/A 1000GP (CEU)
11 58,203,509 58,203,509 NS C/T V/I 1000GP (CEU)
11 58,203,723 58,203,723 SYN G/A F/F 1000GP (CEU, CHBJPT)
11 58,203,729 58,203,729 SYN G/A A/A 1000GP (CEU, CHBJPT)
11 58,204,006 58,204,006 NS A/G I/T 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 238 (Hasin)
11 57,968,679 57,971,714 CopyNumber #72 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T268I S243F V225A V225I F163L I59T % Freq CORP
1 T S V V F I 90.55 0.967
2 T S V V F T 4.53 0.967
3 T S A I F T 2.53 0.967
4 I S V V F I 1.00 0.967
5 T S V I F T 0.61 0.967
6 I S V V F T 0.31 0.967
7 T F V V F I 0.23 0.830
8 T S A V F I 0.08 0.967
9 T S A V F T 0.08 0.967
10 T S V V L I 0.08 0.967

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1S2.aApr07-unspliced main_exon 3UTR chr11 58,203,204 58,203,207 -
CDS chr11 58,203,207 58,204,142 -
5UTR chr11 58,204,142 58,204,181 -