Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2A1 Olfactory Receptor

Gene Symbol OR2A11 (View this gene in GeneCards)
Family 2
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases AC004889-A, OR7-19, HsOR7.6.23, ORL360
External Ids HGNC: 8229   GeneBank: AF399597, BK004418, NM_001005287   ORDB: ORL360   
Build #39 labels OR2A1
Chromosomal location 7:144,318,125-144,319,054 (+)
Cluster 7@144
Synteny CLIC#16
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2A42 100% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2A5 79% 307
Dog OR2A9 84% 310
Dog OR2A9B 83% 310
Chimp CONTIG4416.3-432 81% 303
Mouse Or2a20 80% 310
Rat Or2a20 79% 310
Cow OR2A5 79% 307

Expression evidences

Source Accession
ESTs BX280997
mRNA AX721065

Sequence information

Nucleotide sequence ATGGGGGAAAATCAGACAATGGTCACAGAGTTCCTCCTACTGGGATTTCTCCTGGGCCCA
AGGATTCAGATGCTCCTCTTTGGGCTCTTCTCCCTGTTCTATATCTTCACCCTGCTGGGG
AACGGGGCCATCCTGGGGCTCATCTCACTGGACTCCAGACTCCACACCCCCATGTACTTC
TTCCTCTCACACCTGGCTGTCGTCGACATCGCCTACACCCGCAACACGGTGCCCCAGATG
CTGGCGAACCTCCTGCATCCAGCCAAGCCCATCTCCTTTGCTGGCTGCATGACGCAGACC
TTTCTCTGTTTGAGTTTTGGACACAGCGAATGTCTCCTGCTGGTGCTGATGTCCTACGAT
CGTTACGTGGCCATCTGCCACCCTCTCCGATACTCCGTCATCATGACCTGGAGAGTCTGC
ATCACCCTGGCCGTCACTTCCTGGACGTGTGGCTCCCTCCTGGCTCTGGCCCATGTGGTT
CTCATCCTAAGACTGCCCTTCTCTGGGCCTCATGAAATCAACCACTTCTTCTGTGAAATC
CTGTCTGTCCTCAGGCTGGCCTGTGCTGACACCTGGCTCAACCAGGTGGTCATCTTTGCA
GCCTGCGTGTTCTTCCTGGTGGGGCCACCCAGCCTGGTGCTTGTCTCCTACTCGCACATC
CTGGCGGCCATCCTGAGGATCCAGTCTGGGGAGGGCCGCAGAAAGGCCTTCTCCACCTGC
TCCTCCCACCTCTGCGTGGTGGGACTCTTCTTTGGCAGTGCCATCATCATGTACATGGCC
CCCAAGTCCCGCCATCCTGAGGAGCAGCAAAAGGTCTTTTTTCTATTTTACAGTTTTTTC
AACCCAACACTTAACCCCCTGATTTACAGCCTGAGGAACGGAGAGGTCAAGGGTGCCCTG
AGGAGAGCACTGGGCAAGGAAAGTCATTCC
Conceptual translation MGENQTMVTEFLLLGFLLGPRIQMLLFGLFSLFYIFTLLGNGAILGLISLDSRLHTPMYF
FLSHLAVVDIAYTRNTVPQMLANLLHPAKPISFAGCMTQTFLCLSFGHSECLLLVLMSYD
RYVAICHPLRYSVIMTWRVCITLAVTSWTCGSLLALAHVVLILRLPFSGPHEINHFFCEI
LSVLRLACADTWLNQVVIFAACVFFLVGPPSLVLVSYSHILAAILRIQSGEGRRKAFSTC
SSHLCVVGLFFGSAIIMYMAPKSRHPEEQQKVFFLFYSFFNPTLNPLIYSLRNGEVKGAL
RRALGKESHS

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
7 143,147,775 144,368,638 CopyNumber Variation_3708 (DGV)
7 143,217,296 144,074,520 CopyNumber Variation_32962 (DGV)
7 143,873,741 144,029,792 Inversion Variation_37282 (DGV)
7 143,877,475 144,074,275 CopyNumber Variation_59622 (DGV)
7 143,877,476 144,074,583 CopyNumber Variation_70058 (DGV)
7 143,878,837 144,073,622 CopyNumber Variation_31398 (DGV)
7 143,879,547 144,073,724 CopyNumber Variation_4571 (DGV)
7 143,887,276 144,027,539 CopyNumber Variation_37567 (DGV)
7 143,905,946 144,059,816 CopyNumber Variation_0726 (DGV), Variation_2110 (DGV)
7 143,947,032 144,038,091 Inversion Variation_37283 (DGV)
7 143,963,153 144,073,285 CopyNumber Variation_82244 (DGV), Variation_94944 (DGV)
7 143,972,874 144,109,520 Inversion Variation_37284 (DGV)
7 143,993,383 144,034,914 CopyNumber Variation_70057 (DGV)
7 143,994,640 144,030,630 CopyNumber Variation_82245 (DGV)
7 144,001,319 144,028,345 CopyNumber Variation_94945 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2A1.aApr07-unspliced main_exon 5UTR chr7 144,317,856 144,318,125 +
CDS chr7 144,318,125 144,319,054 +
3UTR chr7 144,319,054 144,319,057 +