Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2A12 Olfactory Receptor

Gene Symbol OR2A121 (View this gene in GeneCards)
Family 2
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.07 (functional)
Aliases OR7-10, HsOR7.6.12
External Ids HGNC: 15082   GeneBank: AB065694, AF399462, AF546378-AF546391, BK004419, NM_001004135   
Build #39 labels OR2A12
Chromosomal location 7:144,095,108-144,096,037 (+)
Cluster 7@144
Synteny CLIC#16
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2A14 74.68% 308
OR2A2 70.32% 310
OR2A5 76.77% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2A12 85% 309
Dog OR2A14 82% 308
Chimp CONTIG227.343-19637 98% 310
Mouse Or2a12 86% 307
Rat Or2a12-ps 82% 311
Cow OR2A12 85% 310

Expression evidences

Source Accession
mRNA BC136903

Sequence information

Nucleotide sequence ATGGAAAGCAATCAGACCTGGATCACAGAAGTCATCCTGTTGGGATTCCAGGTGGACCCA
GCTCTGGAGTTGTTCCTCTTTGGGTTTTTCTTGCTATTCTACAGCTTAACCCTGATGGGA
AATGGGATTATCCTGGGGCTCATCTACTTGGACTCTAGACTGCACACACCCATGTATGTC
TTCCTGTCACACCTGGCCATTGTGGACATGTCCTATGCCTCGAGTACTGTCCCTAAGATG
CTAGCAAATCTTGTGATGCACAAAAAAGTCATCTCCTTTGCTCCTTGCATACTTCAGACT
TTTTTGTATTTGGCGTTTGCTATTACAGAGTGTCTGATTTTGGTGATGATGTGCTATGAT
CGGTATGTGGCAATCTGTCACCCCTTGCAATACACCCTCATTATGAACTGGAGAGTGTGC
ACTGTCCTGGCCTCAACTTGCTGGATATTTAGCTTTCTCTTGGCTCTGGTCCATATTACT
CTTATTCTGAGGCTGCCTTTTTGTGGCCCACAAAAGATCAACCACTTTTTCTGTCAAATC
ATGTCCGTATTCAAATTGGCCTGTGCTGACACTAGGCTCAACCAGGTGGTCCTATTTGCG
GGTTCTGCGTTCATCTTAGTGGGGCCGCTCTGCCTGGTGCTGGTCTCCTACTTGCACATC
CTGGTGGCCATCTTGAGGATCCAGTCTGGGGAGGGCCGCAGAAAGGCCTTCTCTACCTGC
TCCTCCCACCTCTGCGTGGTGGGGCTTTTCTTTGGCAGCGCCATTGTCATGTACATGGCC
CCCAAGTCAAGCCATTCTCAAGAACGGAGGAAGATCCTTTCCCTGTTTTACAGCCTTTTC
AACCCGATCCTGAACCCCCTCATCTACAGCCTTAGGAATGCAGAGGTGAAAGGGGCTCTA
AAGAGAGTCCTTTGGAAACAGAGATCAATG
Conceptual translation MESNQTWITEVILLGFQVDPALELFLFGFFLLFYSLTLMGNGIILGLIYLDSRLHTPMYV
FLSHLAIVDMSYASSTVPKMLANLVMHKKVISFAPCILQTFLYLAFAITECLILVMMCYD
RYVAICHPLQYTLIMNWRVCTVLASTCWIFSFLLALVHITLILRLPFCGPQKINHFFCQI
MSVFKLACADTRLNQVVLFAGSAFILVGPLCLVLVSYLHILVAILRIQSGEGRRKAFSTC
SSHLCVVGLFFGSAIVMYMAPKSSHSQERRKILSLFYSLFNPILNPLIYSLRNAEVKGAL
KRVLWKQRSM

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
7 100 -100 NS G/A S/N 1000GP (YRI, YRI)
7 143,792,867 143,792,867 NS A/G T/A rs9655672 (DbSNP)
7 143,792,991 143,792,991 NS A/G N/S rs34947817 (DbSNP)
7 144,095,898 144,095,898 NS G/A S/N 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
7 143,147,775 144,368,638 CopyNumber Variation_3708 (DGV)
7 143,217,296 144,074,520 CopyNumber Variation_32962 (DGV)
7 143,545,719 143,874,190 CopyNumber Variation_53583 (DGV)
7 143,572,286 143,866,532 CopyNumber Variation_8581 (DGV)
7 143,742,520 143,847,474 CopyNumber Variation_4570 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I91N R138S M181T A223T S264N L279F % Freq CORP
1 I R M A S L 84.87 0.166
2 I R M A N L 12.29 0.166
3 I R M T S L 1.61 0.166
4 I R M A S F 0.61 0.166
5 N R M A N L 0.23 0.249
6 I R T A S L 0.23 0.166
7 I S M A S L 0.15 0.166

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2A12.aApr07-unspliced main_exon CDS chr7 144,095,108 144,096,037 +
3UTR chr7 144,096,037 144,096,040 +