Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2A13P Olfactory Receptor

Gene Symbol OR2A13P1 (View this gene in GeneCards)
Family 2
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases OR7-13, HsOR7.6.16P, ORL3194
External Ids HGNC: 15083   GeneBank: AB065691, AF399460, BK004749, NG_004375   ORDB: ORL3194   
Build #39 labels OR2A13P
Chromosomal location 7:144,142,009-144,142,938 (+)
Cluster 7@144
Synteny CLIC#16
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2A2 84.36% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2A13 84% 306
Mouse Or2a52 78% 310
Rat Or2a52 79% 306
Cow OR2A13 82% 306
Orang OR2A2P 84% 310
Horse OR2A13 82% 310
Horse OR2A75 83% 306
Horse OR2A73 83% 306
Horse OR2A72 82% 306
Chimp OR2A13 95% 310

Expression evidences

Source Accession
mRNA AB529229

Sequence information

Nucleotide sequence ATGGGAGTCAACCAATCATGGGTCACAGAATTCATCCTGGTGGGATTCCAGCTCAGTGCC
GAGATGGAAGTGCTCCTCTTTTAGATCTTCTCCCTGTTATACATCTTCAGCCTGCTGGCA
AATGGCATGATCTTGGGACTCATCTGTCTGGACCACATTCTGCCTACCCCCATGTACTTC
TTCCTCTCACACCTGGCCATCATTGACATGTCCTATGCTTCCAACAATGTTCCCAAGATG
TTGGCAAATCTGATGAACAAGAAAAGAACCATCTCCTTTCTTCCATGCATAATGCAGACC
TATTTGCATTTCTCTTTTGCTGCTACAGAGTGTCTGATTTTGGTGGTGATGTCCTATGAT
AGGTATGTGGCCATTTGCCACCCTCTCCAGTACACTGTCATCATGAGCTGGAGAGTGTGC
ACGATCCTGGCTCTCACATCCTGGTCATGTGGGTTTGCCCTGTCCCTGGTACATGCAATT
CTTCTTCTAAGGTTGCCGTTCTGTGGGCCCCGGGATGTGAACCACCTCTTCTGTGAAATT
CTGTCTGTCCTCAAGCTGGCCTGTTCTGACACCTGGGTTAACCAAGTGGTCATATTTGCT
ACCTGTGTGTTTGTCTTAGTTGGACCTCTTTGTTTGATGCTTGTCTCCTACATGCACATC
CTCTGGGCCATCCTAAAGATCCAGACAAAGGAAGGCCGCATAAAGGCCTTCTCGACCTGC
TCCTCCCACCTGTGTGTGGTTGGACTCTTCTTTGGCATAGCCATGGTGGTTTACATAGTC
CCAGACTCTAATCAACGAGAGGAGCAGGAGAAAATGCTGTCCCTGTTTCACAGTGTCTTG
AACCCAATTCTGAACCCCCTGATCTACAGTCTGAGGAATGCTCAGGTGAAGGGCGCCCTC
CACAGAGCACTGCAGAGGACGCTGTCTATG
Conceptual translation MGVNQSWVTEFILVGFQLSAEMEVLLFXFSLLYIFSLLANGMILGLICLDHILPTPMYF
FLSHLAIIDMSYASNNVPKMLANLMNKKRTISFLPCIMQTYLHFSFAATECLILVVMSYD
RYVAICHPLQYTVIMSWRVCTILALTSWSCGFALSLVHAILLLRLPFCGPRDVNHLFCEI
LSVLKLACSDTWVNQVVIFATCVFVLVGPLCLMLVSYMHILWAILKIQTKEGRIKAFSTC
SSHLCVVGLFFGIAMVVYIVPDSNQREEQEKMLSLFHSVLNPILNPLIYSLRNAQVKGAL
HRALQRTLSM

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
7 100 -100 SNP G/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
7 143,839,211 143,839,211 SNP G/T rs56354727 (DbSNP)
7 143,839,275 143,839,275 SNP A/G rs62482941 (DbSNP)
7 143,839,360 143,839,360 SNP C/A rs2699835 (DbSNP)
7 143,839,408 143,839,408 SNP T/C rs1919954 (DbSNP)
7 143,839,476 143,839,476 SNP C/T rs2684429 (DbSNP)
7 143,839,516 143,839,516 SNP A/G rs55979675 (DbSNP)
7 143,839,601 143,839,601 SNP C/T rs61732173 (DbSNP)
7 143,839,605 143,839,605 SNP T/C rs1919953 (DbSNP)
7 143,839,878 143,839,878 SNP A/G rs61732625 (DbSNP)
7 143,839,898 143,839,898 SNP A/G rs61732618 (DbSNP)
7 144,142,315 144,142,315 SNP C/T 1000GP (CEU, CHBJPT)
7 144,142,512 144,142,512 SNP T/C 1000GP (CEU, CHBJPT)
7 144,142,857 144,142,857 SNP T/G 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
7 143,147,775 144,368,638 CopyNumber Variation_3708 (DGV)
7 143,217,296 144,074,520 CopyNumber Variation_32962 (DGV)
7 143,545,719 143,874,190 CopyNumber Variation_53583 (DGV)
7 143,572,286 143,866,532 CopyNumber Variation_8581 (DGV)
7 143,742,520 143,847,474 CopyNumber Variation_4570 (DGV)
7 143,839,002 143,842,031 Deletion #269 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.