Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2A14 Olfactory Receptor

Gene Symbol OR2A141 (View this gene in GeneCards)
Family 2
Subfamily A
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases OST182, OR7-12, HsOR7.6.15
External Ids HGNC: 15084   GeneBank: AB065693, AF399596, BK004421, NM_001001659   
Build #39 labels OR2A14P, OR2A6
Chromosomal location 7:144,129,113-144,130,042 (+)
Cluster 7@144
Synteny CLIC#16
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2A12 74.68% 308
OR2A2 77.27% 308
OR2A5 79.29% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2A5 79% 308
Mouse Or2a14 83% 308
Rat Or2a14 83% 308
Cow OR2A5 80% 309
Cow OR2A14B 80% 308
Orang OR2A2P 78% 308
Horse OR2A14C 81% 308
Chimp OR2A5 79% 309

Expression evidences

Source Accession
mRNA BC136889

Sequence information

Nucleotide sequence ATGGAAGGCAACAAGACATGGATCACAGACATCACCTTGCCGCGATTCCAGGTTGGTCCA
GCACTGGAGATTCTCCTCTGTGGACTTTTCTCTGCCTTCTATACACTCACCCTGCTGGGG
AATGGGGTCATCTTTGGGATTATCTGCCTGGACTGTAAGCTTCACACACCCATGTACTTC
TTCCTCTCACACCTGGCCATTGTTGACATATCCTATGCTTCCAACTATGTCCCCAAGATG
CTGACGAATCTTATGAACCAGGAAAGCACCATCTCCTTTTTTCCATGCATAATGCAGACA
TTCTTGTATTTGGCTTTTGCTCACGTAGAGTGTCTGATTTTGGTGGTGATGTCCTATGAT
CGCTATGCGGACATCTGCCACCCCTTACGTTACAATAGCCTCATGAGCTGGAGAGTGTGC
ACTGTCCTGGCTGTGGCTTCCTGGGTGTTCAGCTTCCTCCTGGCTCTGGTCCCTTTAGTT
CTCATCCTGAGCCTGCCCTTCTGCGGGCCTCATGAAATCAACCACTTCTTCTGTGAAATC
CTGTCTGTCCTCAAGTTGGCCTGTGCTGACACCTGGCTCAACCAGGTGGTCATCTTTGCA
GCCTGCGTGTTCATCCTGGTGGGGCCACTCTGCCTGGTGCTGGTCTCCTACTTGCGCATC
CTGGCCGCCATCTTGAGGATCCAGTCTGGGGAGGGCCGCAGAAAGGCCTTCTCCACCTGC
TCCTCCCACCTTTGCGTGGTGGGACTCTTCTTTGGCAGCGCCATTGTCACGTACATGGCC
CCCAAGTCCCGCCATCCTGAGGAGCAGCAGAAAGTTCTTTCCCTGTTTTACAGCCTTTTC
AATCCAATGCTGAACCCCCTGATATATAGCCTAAGGAATGCAGAGGTCAAGGGCGCCCTG
AGGAGGGCACTGAGGAAGGAGAGGCTGACG
Conceptual translation MEGNKTWITDITLPRFQVGPALEILLCGLFSAFYTLTLLGNGVIFGIICLDCKLHTPMYF
FLSHLAIVDISYASNYVPKMLTNLMNQESTISFFPCIMQTFLYLAFAHVECLILVVMSYD
RYADICHPLRYNSLMSWRVCTVLAVASWVFSFLLALVPLVLILSLPFCGPHEINHFFCEI
LSVLKLACADTWLNQVVIFAACVFILVGPLCLVLVSYLRILAAILRIQSGEGRRKAFSTC
SSHLCVVGLFFGSAIVTYMAPKSRHPEEQQKVLSLFYSLFNPMLNPLIYSLRNAEVKGAL
RRALRKERLT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
7 100 -100 NS G/T S/I 1000GP (YRI, YRI)
7 143,826,603 143,826,603 NS G/T S/I rs2961160 (DbSNP)
7 143,826,697 143,826,697 NS C/G S/R rs2961161 (DbSNP)
7 143,826,730 143,826,732 Del(3) -/CTT rs66549240 (DbSNP)
7 143,826,735 143,826,737 Del(3) -/TCT rs34602346 (DbSNP)
7 143,826,980 143,826,980 NS A/G M/V rs59781893 (DbSNP)
7 144,129,510 144,129,510 NS G/T S/I 1000GP (CEU, CHBJPT)
7 144,129,604 144,129,604 NS C/G S/R 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 57 (Hasin)
7 143,147,775 144,368,638 CopyNumber Variation_3708 (DGV)
7 143,217,296 144,074,520 CopyNumber Variation_32962 (DGV)
7 143,545,719 143,874,190 CopyNumber Variation_53583 (DGV)
7 143,572,286 143,866,532 CopyNumber Variation_8581 (DGV)
7 143,742,520 143,847,474 CopyNumber Variation_4570 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

P57S S133I P158H S164R % Freq CORP
1 P I P R 61.37 1.000
2 P S P S 36.10 1.000
3 P S P R 1.77 1.000
4 P I H R 0.46 1.000
5 S I P R 0.31 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2A14.aApr07-unspliced main_exon CDS chr7 144,129,113 144,130,042 +
3UTR chr7 144,130,042 144,130,045 +