Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2A15P Olfactory Receptor

Gene Symbol OR2A15P1 (View this gene in GeneCards)
Family 2
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR7.6.14P, ORL3196
External Ids HGNC: 15085   GeneBank: NG_004290   ORDB: ORL3196   
Build #39 labels OR2A28P, OR2A15P
Chromosomal location 7:144,118,464-144,119,360 (-)
Cluster 7@144
Synteny CLIC#16
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2A13P 68.95% 306
OR2A14 76.14% 306
OR2A5 73.86% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2A37 77% 308
Mouse Or2a14 74% 310
Rat Or2a14 74% 310
Cow OR2A5 75% 310
Orang OR2A14 78% 310
Horse OR2A14 72% 308
Chimp OR2A14 77% 309

Sequence information

Nucleotide sequence ATGGGATGTCACCAATCAATGGTCACAGAATTCATCCTGGTGGGATTCCAGCTCAGTGCT
GAGATGGAAGTGCTCCTCTTTTGGAGCTTCTCCCTTGGAATAGCCTTGGAACTCATCTGT
CTGGACCACAGTCTGCACACTCTCATACTTCTTCCTCTCACACCTGGCCGTCATTGACAT
GTCCTATGCTTCCAACAATGTTCCCAAGATGCTGGTGGATCTTGCGAACTAGAAAAGCAC
CATGTGCTTTTTTCCATGCATAATGCAGACATTCTTGTATTTGGCTTTTGCTCACATAGA
GTGTCTGATTTTGGTGGTTTTGTCCTATGATCGCTATGTGGCCATCTGCCACCCCTTACG
TTACAATGTCCTCATGAGCTGGAGAGAGTGCACTGTCCTGGCTGTGGCTTCCTGGGTGTT
CAGCTTCCTCCTGGCTCTGGTCCATTTAGTTCTCATTCTGAGGCTGCCCTTCAGTGGGCT
CATGAAATCAACCACTACTGTGAAATCCTGTCTGTCCTCAAGTTGGCCTGTGCTGACACC
TGGCTCAACCAGGTGGTCATCTTTGCAGCCTGCATGTTCATCCTGGTAGGGTCACTCTGC
CTGGTGCTGGTCTCTTACTTGGGCATCCTGGCGGCCATCCTGAGGATCCAGTCTGGCGAG
GGCCGCAGAAAGGCCTTCTCTACCTGCTCCTCCCACCTCTGTGTGGTGGAGTTCTTCTTT
GGCAACGCCATTGTCATGTACATGGCCCCCAAGTCCCGCCATCCCGAGGAGCAGCAGAAG
GTCCTTTCCCTGTTTTGCAGCCTTTGGAATCAGGTGCTGAACCCTCTGATCTACAGCTTG
AGGAATGCAGAGGTCAAGAGTGCCCAGAAGAGGGCACTGAGGAAGGAGAGGCTGATG
Conceptual translation MGCHQSMVTEFILVGFQLSAEMEVLLFWSFSLGIALELICLDHSLHT\YFFLSHLAVID
MSYASNNVPKMLVDLANXSTMCFFPCIMQTFLYLAFAHIECLILVVLSYDRYVAICHPL
RYNVLMSWRECTVLAVASWVFSFLLALVHLVLILRLPFSG/HEINHYCEILSVLKLACA
DTWLNQVVIFAACMFILVGSLCLVLVSYLGILAAILRIQSGEGRRKAFSTCSSHLCVVEF
FFGNAIVMYMAPKSRHPEEQQKVLSLFCSLWNQVLNPLIYSLRNAEVKSAQKRALRKERL
M

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
7 100 -100 SNP A/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
7 143,815,689 143,815,689 SNP A/G rs28647821 (DbSNP)
7 143,815,744 143,815,744 SNP C/T rs10263904 (DbSNP)
7 143,815,780 143,815,780 SNP G/T rs10274340 (DbSNP)
7 143,815,789 143,815,789 SNP C/T rs10245844 (DbSNP)
7 143,815,861 143,815,861 SNP C/G rs2961155 (DbSNP)
7 143,816,218 143,816,217 Ins(1) -/T rs34690123 (DbSNP)
7 143,816,228 143,816,228 SNP T/C rs2951294 (DbSNP)
7 143,816,388 143,816,388 SNP C/T rs57185614 (DbSNP)
7 144,118,651 144,118,651 SNP T/C 1000GP (CEU, CHBJPT)
7 144,118,687 144,118,687 SNP G/T 1000GP (CEU, CHBJPT)
7 144,118,696 144,118,696 SNP C/T 1000GP (CEU, CHBJPT)
7 144,118,704 144,118,704 SNP G/C 1000GP (CHBJPT)
7 144,118,768 144,118,768 SNP G/C 1000GP (CEU, CHBJPT)
7 144,118,864 144,118,864 SNP T/A 1000GP (CEU, CHBJPT)
7 144,119,135 144,119,135 SNP C/T 1000GP (CEU, CHBJPT)
7 144,119,180 144,119,180 SNP C/T 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 74 (Hasin)
7 143,147,775 144,368,638 CopyNumber Variation_3708 (DGV)
7 143,217,296 144,074,520 CopyNumber Variation_32962 (DGV)
7 143,545,719 143,874,190 CopyNumber Variation_53583 (DGV)
7 143,572,286 143,866,532 CopyNumber Variation_8581 (DGV)
7 143,742,520 143,847,474 CopyNumber Variation_4570 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.