Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2A2 Olfactory Receptor

Gene Symbol OR2A21 (View this gene in GeneCards)
Family 2
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.01 (functional)
Aliases OR7-11, OST008, HsOR7.6.13
External Ids HGNC: 8230   GeneBank: AB065695, AF399459, BK004420, NM_001005480, XM_499490   
Build #39 labels OR2A2, OR2A17P, OR2A2P
Chromosomal location 7:144,109,583-144,110,536 (+)
Cluster 7@144
Synteny CLIC#16
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2A13P 84.36% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2A13 78% 307
Chimp CONTIG227.343-5079 98% 318
Mouse Or2a14 75% 310
Rat Or2a14 75% 310
Cow OR2A13 75% 307

Expression evidences

Source Accession
mRNA BC136742

Sequence information

Nucleotide sequence ATGGAAGGCAACCAGACATGGATCACAGACATCACCCTGCTGGGATTCCAGGTTGGTCCA
GCACTGGCGATTCTCCTCTGTGGACTCTTCTCTGTCTTCTATACACTCACCCTGCTGGGG
AATGGGGTCATCTTTGGGATTATCTGCCTGGACTCTAAGCTTCACACACCCATGTACTTC
TTCCTCTCACACCTGGCCATCATTGACATGTCCTATGCTTCCAACAATGTTCCCAAGATG
TTGGCAAACCTAATGAACCAGAAAAGAACCATCTCCTTTGTTCCATGCATAATGCAGACT
TTTTTGTATTTGGCTTTTGCTGTTACAGAGTGCCTGATTTTGGTGGTGATGTCCTATGAT
AGGTATGTGGCCATCTGCCACCCTTTCCAGTACACTGTCATCATGAGCTGGAGAGTGTGC
ACGATCCTGGTTCTCACGTCCTGGTCATGTGGGTTTGCCCTGTCCCTGGTACATGAAATT
CTCCTTCTAAGGTTGCCCTTCTGTGGGCCCCGGGATGTGAACCACCTCTTCTGTGAAATT
CTGTCTGTCCTCAAGCTGGCCTGTGCTGACACCTGGGTTAACCAAGTGGTCATATTTGCT
ACCTGTGTGTTTGTCTTAGTCGGGCCTCTTTCCTTGATTCTGGTCTCCTACATGCACATC
CTCGGGGCCATCCTGAAGATCCAGACAAAGGAGGGCCGCATAAAGGCCTTCTCCACCTGC
TCCTCCCACCTGTGTGTGGTTGGACTATTCTTTGGCATAGCCATGGTGGTTTACATGGTC
CCAGACTCTAATCAACGAGAGGAGCAGGAGAAAATGCTGTCCCTGTTTCACAGTGTCTTT
AATCCAATGCTGAACCCCCTGATCTACAGCCTGAGGAATGCTCAGTTGAAGGGCGCCCTC
CACAGAGCACTCCAGAGGAAGAGGTCCATGAGAACGGTGTATGGGCTTTGCCTT
Conceptual translation MEGNQTWITDITLLGFQVGPALAILLCGLFSVFYTLTLLGNGVIFGIICLDSKLHTPMYF
FLSHLAIIDMSYASNNVPKMLANLMNQKRTISFVPCIMQTFLYLAFAVTECLILVVMSYD
RYVAICHPFQYTVIMSWRVCTILVLTSWSCGFALSLVHEILLLRLPFCGPRDVNHLFCEI
LSVLKLACADTWVNQVVIFATCVFVLVGPLSLILVSYMHILGAILKIQTKEGRIKAFSTC
SSHLCVVGLFFGIAMVVYMVPDSNQREEQEKMLSLFHSVFNPMLNPLIYSLRNAQLKGAL
HRALQRKRSMRTVYGLCL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
7 100 -100 NS C/A Q/K 1000GP (YRI, YRI, YRI, YRI, YRI)
7 100 -100 SYN T/C N/N 1000GP (YRI)
7 143,806,688 143,806,688 NS A/C K/Q rs10230228 (DbSNP)
7 143,806,924 143,806,924 SYN C/T N/N rs2684427 (DbSNP)
7 143,806,927 143,806,927 SYN A/G L/L rs2684428 (DbSNP)
7 143,806,930 143,806,930 NS G/A M/I rs72503054 (DbSNP)
7 143,806,934 143,806,934 NS A/C K/Q rs61734798 (DbSNP)
7 143,806,955 143,806,955 NS C/G L/V rs61729718 (DbSNP)
7 143,806,977 143,806,977 NS A/T Y/F rs61734817 (DbSNP)
7 143,806,987 143,806,987 NS C/G F/L rs61734820 (DbSNP)
7 143,806,988 143,806,988 NS G/T A/S rs61734821 (DbSNP)
7 143,806,998 143,806,998 NS C/T A/V rs61734823 (DbSNP)
7 143,807,008 143,807,008 SYN C/T C/C rs61734829 (DbSNP)
7 143,807,112 143,807,112 NS C/G T/R rs61735905 (DbSNP)
7 143,807,186 143,807,186 NS C/T R/W rs73728207 (DbSNP)
7 143,807,304 143,807,304 NS C/T P/L rs10252253 (DbSNP)
7 143,807,515 143,807,515 NS G/T L/F rs2961149 (DbSNP)
7 143,807,518 143,807,518 SYN C/T N/N rs2951315 (DbSNP)
7 144,109,595 144,109,595 NS C/A Q/K 1000GP (CEU)
7 144,110,211 144,110,211 NS T/C L/P 1000GP (CEU)
7 144,110,422 144,110,422 NS T/G F/L 1000GP (CEU)
7 144,110,425 144,110,425 SYN T/C N/N 1000GP (CEU)
7 144,110,476 144,110,476 SYN C/T G/G 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
7 143,147,775 144,368,638 CopyNumber Variation_3708 (DGV)
7 143,217,296 144,074,520 CopyNumber Variation_32962 (DGV)
7 143,545,719 143,874,190 CopyNumber Variation_53583 (DGV)
7 143,572,286 143,866,532 CopyNumber Variation_8581 (DGV)
7 143,742,520 143,847,474 CopyNumber Variation_4570 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Q5K I68F R89G T146R L210P V260D F280L % Freq CORP
1 Q I R T L V L 42.24 0.013
2 Q I R T L V F 39.17 0.013
3 K I R T P V F 13.82 0.013
4 K I R R P V F 1.46 0.013
5 K F R T P V F 1.08 0.013
6 K I G T P V F 0.84 0.013
7 Q I R T L D L 0.54 0.013
8 Q I R T P V F 0.38 0.013
9 Q I R T L D F 0.38 0.013
10 Q I R R L V L 0.08 0.013

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2A2.aApr07-unspliced main_exon CDS chr7 144,109,583 144,110,536 +
3UTR chr7 144,110,536 144,110,539 +