Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2A20P Olfactory Receptor

Gene Symbol OR2A20P1 (View this gene in GeneCards)
Family 2
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases OR7-86, OR7-17
External Ids HGNC: 15413   GeneBank: AB065477, AB065610, AF399463, AF546392-AF546405, BK004757, NR_002157, NR_002158, U86282   
Build #39 labels OR2A20
Chromosomal location 7:144,250,674-144,251,603 (-)
Cluster 7@144
Synteny CLIC#16
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2A9P 100% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2A9 86% 310
Dog OR2A9B 85% 310
Mouse Or2a20 81% 310
Rat Or2a20 81% 310
Cow OR2A5 79% 307
Orang OR2A9 91% 310
Orang OR2A42 89% 310
Horse OR2A9 87% 310
Horse OR2A9BP 85% 309
Chimp OR2A42 91% 310

Expression evidences

Source Accession
ESTs W03780
mRNA AB464440

Sequence information

Nucleotide sequence ATGGTGAAAAATCAGACAATGGTCACAGAGTTCCTCCTACTGGGATTTCTCCTGGGCCCA
AGGATTCAGATGCTCCTCTTTGGGCTCTTCTCCCTGTTCTATGTCTTCACCCTGCTGGGG
AATGGGACCATCCTGGGGCTCATCTCACTGGACTCCAGACTCCACACCCCCATGTACTTC
TTCCTCTCACACCTGGCCGTCGTCAACATCGCCTATGCCTGCAACACAGTGCCCCAGATG
CTGGTGAACCTCCTGCATCCAGCCAAGCCCATCTCCTTTGCTGGCTGCATGACATAGACC
TTTCTCTTTTTGAGTTTTGCACATACTGAATGCCTCCTGTTGGTGCTGATGTCCTACGAT
CGGTACGTGGCCATCTGCCACCCTCTCCGATATTTCATCATCATGACCTGGAAAGTCTGC
ATCACTCTGGCCATCACTTCCTGGACATGTGGCTCCCTCCTGGCTATGGTCCATGTGAGC
CTCATCCTAAGACTGCCCTTTTGTGGGCCTCGTGAAATCAACCACTTCTTCTGTGAAATC
CTGTCTGTCCTCAGGCTGGCCTGTGCTGATACCTGGCTCAACCAGGTGGTCATCTTTGCA
GCCTGCATGTTCATCCTGGTGGGACCACTCTGCCTGGTGCTGGTCTCCTACTCACACATC
CTGGCGGCCATCCTGAGGATCCAGTCTGGGGAGGGCCGCAGAAAGGCCTTCTCCACCTGC
TCCTCCCACCTCTGCGTAGTGGGACTCTTCTTTGGCAGCGCCATCGTCATGTACATGGCC
CCTAAGTCCCGCCATCCTGAGGAGCAGCAGAAGGTCCTTTTTCTATTTTACAGTTCTTTC
AACCCGATGCTAAACCCCCTGATTTACAACCTGAGGAATGTAGAGGTCAAGGGTGCCCTG
AGGAGAGCACTGTGCAAGGAAAGTCATTCC
Conceptual translation MVKNQTMVTEFLLLGFLLGPRIQMLLFGLFSLFYVFTLLGNGTILGLISLDSRLHTPMYF
FLSHLAVVNIAYACNTVPQMLVNLLHPAKPISFAGCMTXFLFLSFAHTECLLLVLMSYD
RYVAICHPLRYFIIMTWKVCITLAITSWTCGSLLAMVHVSLILRLPFCGPREINHFFCEI
LSVLRLACADTWLNQVVIFAACMFILVGPLCLVLVSYSHILAAILRIQSGEGRRKAFSTC
SSHLCVVGLFFGSAIVMYMAPKSRHPEEQQKVLFLFYSSFNPMLNPLIYNLRNVEVKGAL
RRALCKESHS

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
CopyNumber 244 (Hasin)
7 143,147,775 144,368,638 CopyNumber Variation_3708 (DGV)
7 143,217,296 144,074,520 CopyNumber Variation_32962 (DGV)
7 143,873,741 144,029,792 Inversion Variation_37282 (DGV)
7 143,875,423 143,961,876 CopyNumber Variation_82237 (DGV), Variation_94936 (DGV)
7 143,877,475 144,074,275 CopyNumber Variation_59622 (DGV)
7 143,877,476 144,074,583 CopyNumber Variation_70058 (DGV)
7 143,878,837 144,073,622 CopyNumber Variation_31398 (DGV)
7 143,879,547 144,073,724 CopyNumber Variation_4571 (DGV)
7 143,884,053 143,953,444 CopyNumber Variation_7612 (DGV)
7 143,884,187 143,962,488 CopyNumber Variation_70061 (DGV)
7 143,887,276 144,027,539 CopyNumber Variation_37567 (DGV)
7 143,905,946 144,059,816 CopyNumber Variation_0726 (DGV), Variation_2110 (DGV)
7 143,910,318 143,961,876 CopyNumber Variation_82238 (DGV)
7 143,910,426 143,961,876 CopyNumber Variation_94938 (DGV)
7 143,945,278 143,999,781 Inversion Variation_59845 (DGV)
7 143,947,032 144,038,091 Inversion Variation_37283 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2A9P.cApr07 main_exon 3UTR chr7 144,250,042 144,250,674 -
CDS chr7 144,250,674 144,251,603 -
5UTR chr7 144,251,603 144,254,696 -
exon_5UTR chr7 144,354,032 144,354,160 -
exon_5UTR chr7 144,355,338 144,355,368 -
OR2A9P.eApr07 main_exon CDS_partial chr7 144,251,265 144,251,603 -
5UTR chr7 144,251,603 144,251,610 -
exon_5UTR chr7 144,254,434 144,254,696 -
exon_5UTR chr7 144,354,982 144,355,138 -
OR2A9P.fApr07 main_exon CDS_partial chr7 144,251,023 144,251,603 -
5UTR chr7 144,251,603 144,251,610 -
exon_5UTR chr7 144,355,338 144,355,706 -
OR2A9P.qApr07 main_exon CDS_partial chr7 144,250,948 144,251,603 -
5UTR chr7 144,251,603 144,251,610 -
exon_5UTR chr7 144,252,296 144,252,492 -
exon_5UTR chr7 144,253,533 144,253,588 -
exon_5UTR chr7 144,254,434 144,254,695 -
OR2A9P.sApr07 main_exon CDS_partial chr7 144,251,387 144,251,603 -
5UTR chr7 144,251,603 144,251,610 -
exon_5UTR chr7 144,343,187 144,343,298 -
exon_5UTR chr7 144,349,104 144,349,443 -
exon_5UTR chr7 144,350,718 144,350,824 -
exon_5UTR chr7 144,355,338 144,355,400 -
OR2A9P.tApr07 main_exon CDS_partial chr7 144,251,369 144,251,603 -
5UTR chr7 144,251,603 144,251,610 -
exon_5UTR chr7 144,311,591 144,311,704 -
exon_5UTR chr7 144,311,884 144,311,936 -
exon_5UTR chr7 144,343,187 144,343,298 -
exon_5UTR chr7 144,350,718 144,350,824 -
exon_5UTR chr7 144,355,338 144,355,529 -