Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2A25 Olfactory Receptor

Gene Symbol OR2A251 (View this gene in GeneCards)
Family 2
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.18 (functional)
Aliases HsOR7.6.11
External Ids HGNC: 19562   GeneBank: NM_001004488   
Build #39 labels OR2A25P, OR2A27
Chromosomal location 7:144,074,220-144,075,149 (+)
Cluster 7@144
Synteny CLIC#16
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2A4 79.55% 308
OR2A7 80.19% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2A25 84% 310
Dog OR2A7 81% 308
Chimp CONTIG227.349-1394 99% 310
Mouse Or2a25 82% 310
Rat Or2a25 82% 310
Cow OR2A7 78% 304
Cow OR2A7BP 80% 291

Expression evidences

Source Accession
mRNA BC136829

Sequence information

Nucleotide sequence ATGGGGGGAAATCAGACTTCCATCACAGAGTTCCTCCTACTGGGATTTCCCATTGGCCCA
AGGATTCAGATGCTCCTCTTTGGGCTCTTCTCCCTGTTCTACATCTTCATTCTGTTGGGG
AACGGGACAATCCTGGGGCTCATCTCACTGGACTCCAGACTCCACACCCCCATGTACTTC
TTCCTCTCACACCTGGCGGTCGTCGACATCGCCTGTGCTTGCAGCACGGTGCCCCAGATG
CTGGTGAACCTCCTGCATCCAGCCAAGCCCATCTCCTTTGCTGGCTGCATGACCCAGATG
TTTCTGTTTTTGAGTTTTGCACATACAGAATGTCTCCTCCTGGTGGTGATGTCCTATGAT
CGGTACGTGGCCATCTGCCACCCTCTCCGATATTCTACCATCATGACCTGGAAAGTCTGC
ATCACTTTGGCATTGACTTCCTGGATTTTAGGAGTCTTATTGGCCCTTGTCCATCTAGTG
TTACTGCTACCACTGTCCTTCTGTGGACCCCAGAAACTTAATCACTTTTTCTGTGAAATT
ATGGCTGTTCTCAAACTTGCCTGTGCGGATACCCACATTAATGAGGTAATGGTTTTGGCA
GGGGCAGTGTCTGTGCTGGTGGGAGCCTTCTTTTCCACTGTAATATCTTATGTTCATATT
CTATGTGCCATTCTAAAGATCCAGTCAGGAGAGGGGTGCCAGAAAGCCTTCTCCATCTGC
TCCTCCCACCTCTGTGTGGTTGGACTCTTTTATGGCACAGCCATCATCATGTATGTTGAG
CCCCAGTATGAGAGCCCCAAGGAGCAGAAGAAATATCTCCTGCTGTTTCACAGCCTCTTC
AATCCCATGCTTAATCCCCTAATTTATAGTCTTAGGAACAAGGAAGTCCAAGGTACTCTA
AAGAGGATGCTTGAAAAGAAGAGAACTTCA
Conceptual translation MGGNQTSITEFLLLGFPIGPRIQMLLFGLFSLFYIFILLGNGTILGLISLDSRLHTPMYF
FLSHLAVVDIACACSTVPQMLVNLLHPAKPISFAGCMTQMFLFLSFAHTECLLLVVMSYD
RYVAICHPLRYSTIMTWKVCITLALTSWILGVLLALVHLVLLLPLSFCGPQKLNHFFCEI
MAVLKLACADTHINEVMVLAGAVSVLVGAFFSTVISYVHILCAILKIQSGEGCQKAFSIC
SSHLCVVGLFYGTAIIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVQGTL
KRMLEKKRTS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
7 100 -100 NS G/A S/N 1000GP (YRI, YRI)
7 100 -100 SYN G/C L/L 1000GP (YRI, YRI)
7 143,771,408 143,771,408 SYN C/G L/L rs59319753 (DbSNP)
7 143,771,536 143,771,536 NS A/G N/S rs6951485 (DbSNP)
7 143,771,557 143,771,557 NS C/T A/V rs61731397 (DbSNP)
7 143,771,937 143,771,937 NS C/G P/A rs2961135 (DbSNP)
7 143,772,218 143,772,218 SYN A/G R/R rs61729541 (DbSNP)
7 144,074,315 144,074,315 SYN G/C L/L 1000GP (CEU, CHBJPT)
7 144,074,443 144,074,443 NS G/A S/N 1000GP (CEU, CHBJPT)
7 144,074,844 144,074,844 NS G/C A/P 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
7 143,147,775 144,368,638 CopyNumber Variation_3708 (DGV)
7 143,217,296 144,074,520 CopyNumber Variation_32962 (DGV)
7 143,545,719 143,874,190 CopyNumber Variation_53583 (DGV)
7 143,572,286 143,866,532 CopyNumber Variation_8581 (DGV)
7 143,742,520 143,847,474 CopyNumber Variation_4570 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G2A S75N V82A A209P G298A % Freq CORP
1 G N V P G 41.01 0.206
2 G S V A G 35.18 0.206
3 G N A P G 13.36 0.206
4 G N V A G 6.14 0.206
5 G S V P G 3.53 0.206
6 G N A A G 0.31 0.206
7 G N V P A 0.23 0.206
8 G S A A G 0.08 0.206
9 G N V A A 0.08 0.206
10 A N V P G 0.08 0.206

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2A25.aApr07-unspliced main_exon CDS chr7 144,074,220 144,075,149 +
3UTR chr7 144,075,149 144,075,152 +