Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2A4 Olfactory Receptor

Gene Symbol OR2A41 (View this gene in GeneCards)
Family 2
Subfamily A
Pseudogene No
CORP pseudogene probability score
Aliases OR6-37, WUGSC:H_DJ0988G15.2, HsOR6.4.1, ORL732
External Ids HGNC: 14729   GeneBank: BK004444, NM_030908   ORDB: ORL732   
Build #39 labels OR2A10, OR2A4
Chromosomal location 6:131,700,472-131,701,401 (-)
Cluster 6@132
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2A7 99.03% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2A7 84% 310
Chimp CONTIG227.349-1394 80% 308
Mouse Or2a7 81% 310
Rat Or2a25 76% 307
Cow OR2A7 78% 307

Expression evidences

Source Accession
ESTs H62445
mRNA BC120954
GNF Atlas2 219912_s_at

Sequence information

Nucleotide sequence ATGGGAGACAATATAACATCCATCAGAGAGTTCCTCCTACTGGGATTTCCCGTTGGCCCA
AGGATTCAGATGCTCCTCTTTGGGCTCTTCTCCCTGTTCTACGTCTTCACCCTGCTGGGG
AACGGGACCATACTGGGGCTCATCTCACTGGACTCCAGACTGCACGCCCCCATGTACTTC
TTCCTCTCACACCTGGCGGTCGTCGACATCGCCTACGCCTGCAACACGGTGCCCCGGATG
CTGGTGAACCTCCTGCATCCAGCCAAGCCCATCTCCTTTGCGGGCCGCATGATGCAGACC
TTTCTGTTTTCCACTTTTGCTGTCACAGAATGTCTCCTCCTGGTGGTGATGTCCTATGAT
CTGTACGTGGCCATCTGCCACCCCCTCCGATATTTGGCCATCATGACCTGGAGAGTCTGC
ATCACCCTCGCGGTGACTTCCTGGACCACTGGAGTCCTTTTATCCTTGATTCATCTTGTG
TTACTTCTACCTTTACCCTTCTGTAGGCCCCAGAAAATTTATCACTTTTTTTGTGAAATC
TTGGCTGTTCTCAAACTTGCCTGTGCAGATACCCACATCAATGAGAACATGGTCTTGGCC
GGAGCAATTTCTGGGCTGGTGGGACCCTTGTCCACAATTGTAGTTTCATATATGTGCATC
CTCTGTGCTATCCTTCAGATCCAATCAAGGGAAGTTCAGAGGAAAGCCTTCCGCACCTGC
TTCTCCCACCTCTGTGTGATTGGACTCGTTTATGGCACAGCCATTATCATGTATGTTGGA
CCCAGATATGGGAACCCCAAGGAGCAGAAGAAATATCTCCTGCTGTTTCACAGCCTCTTT
AATCCCATGCTCAATCCCCTTATCTGTAGTCTTAGGAACTCAGAAGTGAAGAATACTTTG
AAGAGAGTGCTGGGAGTAGAAAGGGCTTTA
Conceptual translation MGDNITSIREFLLLGFPVGPRIQMLLFGLFSLFYVFTLLGNGTILGLISLDSRLHAPMYF
FLSHLAVVDIAYACNTVPRMLVNLLHPAKPISFAGRMMQTFLFSTFAVTECLLLVVMSYD
LYVAICHPLRYLAIMTWRVCITLAVTSWTTGVLLSLIHLVLLLPLPFCRPQKIYHFFCEI
LAVLKLACADTHINENMVLAGAISGLVGPLSTIVVSYMCILCAILQIQSREVQRKAFRTC
FSHLCVIGLVYGTAIIMYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLICSLRNSEVKNTL
KRVLGVERAL

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
CopyNumber 55 (Hasin)
6 132,006,529 132,212,173 CopyNumber Variation_32838 (DGV)
6 132,018,772 132,036,315 CopyNumber Variation_69603 (DGV)
6 132,019,301 132,029,571 CopyNumber Variation_69604 (DGV)
6 132,019,359 132,028,548 CopyNumber Variation_81589 (DGV), Variation_94012 (DGV)
6 132,019,359 132,036,050 CopyNumber Variation_81590 (DGV), Variation_94014 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2A4.aApr07-unspliced main_exon 3UTR chr6 131,699,644 131,700,472 -
CDS chr6 131,700,472 131,701,401 -