Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2A42 Olfactory Receptor

Gene Symbol OR2A421 (View this gene in GeneCards)
Family 2
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR7-16, HsOR7.6.19
External Ids HGNC: 31230   GeneBank: AB065692, BK004217, NM_001001802   
Build #39 labels
Chromosomal location 7:144,231,914-144,232,843 (-)
Cluster 7@144
Synteny CLIC#16
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2A1 100% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2A5 79% 307
Dog OR2A9 84% 310
Dog OR2A9B 83% 310
Chimp CONTIG4416.3-432 81% 303
Mouse Or2a20 80% 310
Rat Or2a20 79% 310
Cow OR2A5 79% 307

Expression evidences

Source Accession
ESTs BX280997

Sequence information

Nucleotide sequence ATGGGGGAAAATCAGACAATGGTCACAGAGTTCCTCCTACTGGGATTTCTCCTGGGCCCA
AGGATTCAGATGCTCCTCTTTGGGCTCTTCTCCCTGTTCTATATCTTCACCCTGCTGGGG
AACGGGGCCATCCTGGGGCTCATCTCACTGGACTCCAGACTCCACACCCCCATGTACTTC
TTCCTCTCACACCTGGCTGTCGTCGACATCGCCTACACCCGCAACACGGTGCCCCAGATG
CTGGCGAACCTCCTGCATCCAGCCAAGCCCATCTCCTTTGCTGGTTGCATGACGCAGACC
TTTCTCTGTTTGAGTTTTGGACACAGCGAATGTCTCCTGCTGGTGCTGATGTCCTACGAT
CGTTACGTGGCCATCTGCCACCCTCTCCGATACTCCGTCATCATGACCTGGAGAGTCTGC
ATCACCCTGGCCGTCACTTCCTGGACGTGTGGCTCCCTCCTGGCTCTGGCCCATGTGGTT
CTCATCCTAAGACTGCCCTTCTCTGGGCCTCATGAAATCAACCACTTCTTCTGTGAAATC
CTGTCTGTCCTCAGGCTGGCCTGTGCTGACACCTGGCTCAACCAGGTGGTCATCTTTGCA
GCCTGCGTGTTCTTCCTGGTGGGGCCACCCAGCCTGGTGCTTGTCTCCTACTCGCACATC
CTGGCGGCCATCCTGAGGATCCAGTCTGGGGAGGGCCGCAGAAAGGCCTTCTCCACCTGC
TCCTCCCACCTCTGCGTGGTGGGACTCTTCTTTGGCAGTGCCATCATCATGTACATGGCC
CCCAAGTCCCGCCATCCTGAGGAGCAGCAAAAGGTCTTTTTTCTATTTTACAGTTTTTTC
AACCCAACACTTAACCCCCTGATTTACAGCCTGAGGAACGGAGAGGTCAAGGGTGCCCTG
AGGAGAGCACTGGGCAAGGAAAGTCATTCC
Conceptual translation MGENQTMVTEFLLLGFLLGPRIQMLLFGLFSLFYIFTLLGNGAILGLISLDSRLHTPMYF
FLSHLAVVDIAYTRNTVPQMLANLLHPAKPISFAGCMTQTFLCLSFGHSECLLLVLMSYD
RYVAICHPLRYSVIMTWRVCITLAVTSWTCGSLLALAHVVLILRLPFSGPHEINHFFCEI
LSVLRLACADTWLNQVVIFAACVFFLVGPPSLVLVSYSHILAAILRIQSGEGRRKAFSTC
SSHLCVVGLFFGSAIIMYMAPKSRHPEEQQKVFFLFYSFFNPTLNPLIYSLRNGEVKGAL
RRALGKESHS

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
7 143,147,775 144,368,638 CopyNumber Variation_3708 (DGV)
7 143,217,296 144,074,520 CopyNumber Variation_32962 (DGV)
7 143,873,741 144,029,792 Inversion Variation_37282 (DGV)
7 143,875,423 143,961,876 CopyNumber Variation_82237 (DGV), Variation_94936 (DGV)
7 143,877,475 144,074,275 CopyNumber Variation_59622 (DGV)
7 143,877,476 144,074,583 CopyNumber Variation_70058 (DGV)
7 143,878,837 144,073,622 CopyNumber Variation_31398 (DGV)
7 143,879,547 144,073,724 CopyNumber Variation_4571 (DGV)
7 143,884,053 143,953,444 CopyNumber Variation_7612 (DGV)
7 143,884,187 143,962,488 CopyNumber Variation_70061 (DGV)
7 143,887,276 144,027,539 CopyNumber Variation_37567 (DGV)
7 143,905,946 144,059,816 CopyNumber Variation_0726 (DGV), Variation_2110 (DGV)
7 143,910,318 143,961,876 CopyNumber Variation_82238 (DGV)
7 143,910,426 143,961,876 CopyNumber Variation_94938 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2A42.aApr07-unspliced main_exon 3UTR chr7 144,231,911 144,231,914 -
CDS chr7 144,231,914 144,232,843 -
5UTR chr7 144,232,843 144,233,112 -