Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2A7 Olfactory Receptor

Gene Symbol OR2A71 (View this gene in GeneCards)
Family 2
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.99 (pseudogene)
Aliases HSDJ0798C17, OR7-18, OR7-20, HsOR7.6.21, ORL3181
External Ids HGNC: 8234   GeneBank: AF399598, BK004218, BK004610, NM_001005328   ORDB: ORL3181   
Build #39 labels OR2A7
Chromosomal location 7:144,258,699-144,259,628 (-)
Cluster 7@144
Synteny CLIC#16
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2A4 99.03% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2A7 85% 310
Chimp CONTIG227.349-1394 81% 308
Mouse Or2a7 82% 310
Rat Or2a25 77% 307
Cow OR2A7 79% 307
Cow OR2A7BP 80% 291

Expression evidences

Source Accession
ESTs H62445
mRNA DQ786236

Sequence information

Nucleotide sequence ATGGGGGACAATATAACATCCATCACAGAGTTCCTCCTACTGGGATTTCCCGTTGGCCCA
AGGATTCAGATGCTCCTCTTTGGGCTCTTCTCCCTGTTCTACGTCTTCACCCTGCTGGGG
AACGGGACCATACTGGGGCTCATCTCACTGGACTCCAGACTGCACGCCCCCATGTACTTC
TTCCTCTCACACCTGGCGGTCGTCGACATCGCCTACGCCTGCAACACGGTGCCCCGGATG
CTGGTGAACCTCCTGCATCCAGCCAAGCCCATCTCCTTTGCGGGCCGCATGATGCAGACC
TTTCTGTTTTCCACTTTTGCTGTCACAGAATGTCTCCTCCTGGTGGTGATGTCCTATGAT
CTGTACGTGGCCATCTGCCACCCCCTCCGATATTTGGCCATCATGACCTGGAGAGTCTGC
ATCACCCTCGCGGTGACTTCCTGGACCACTGGAGTCCTTTTATCCTTGATTCATCTTGTG
TTACTTCTACCTTTACCCTTCTGTAGGCCCCAGAAAATTTATCACTTTTTTTGTGAAATC
TTGGCTGTTCTCAAACTTGCCTGTGCAGATACCCACATCAATGAGAACATGGTCTTGGCC
GGAGCAATTTCTGGGCTGGTGGGACCCTTGTCCACAATTGTAGTTTCATATATGTGCATC
CTCTGTGCTATCCTTCAGATCCAATCAAGGGAAGTTCAGAGGAAAGCCTTCTGCACCTGC
TTCTCCCACCTCTGTGTGATTGGACTCTTTTATGGCACAGCCATTATCATGTATGTTGGA
CCCAGATATGGGAACCCCAAGGAGCAGAAGAAATATCTCCTGCTGTTTCACAGCCTCTTT
AATCCCATGCTCAATCCCCTTATCTGTAGTCTTAGGAACTCAGAAGTGAAGAATACTTTG
AAGAGAGTGCTGGGAGTAGAAAGGGCTTTA
Conceptual translation MGDNITSITEFLLLGFPVGPRIQMLLFGLFSLFYVFTLLGNGTILGLISLDSRLHAPMYF
FLSHLAVVDIAYACNTVPRMLVNLLHPAKPISFAGRMMQTFLFSTFAVTECLLLVVMSYD
LYVAICHPLRYLAIMTWRVCITLAVTSWTTGVLLSLIHLVLLLPLPFCRPQKIYHFFCEI
LAVLKLACADTHINENMVLAGAISGLVGPLSTIVVSYMCILCAILQIQSREVQRKAFCTC
FSHLCVIGLFYGTAIIMYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLICSLRNSEVKNTL
KRVLGVERAL

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
CopyNumber 204 (Hasin)
7 143,147,775 144,368,638 CopyNumber Variation_3708 (DGV)
7 143,217,296 144,074,520 CopyNumber Variation_32962 (DGV)
7 143,873,741 144,029,792 Inversion Variation_37282 (DGV)
7 143,875,423 143,961,876 CopyNumber Variation_82237 (DGV), Variation_94936 (DGV)
7 143,877,475 144,074,275 CopyNumber Variation_59622 (DGV)
7 143,877,476 144,074,583 CopyNumber Variation_70058 (DGV)
7 143,878,837 144,073,622 CopyNumber Variation_31398 (DGV)
7 143,879,547 144,073,724 CopyNumber Variation_4571 (DGV)
7 143,884,187 143,962,488 CopyNumber Variation_70061 (DGV)
7 143,887,276 144,027,539 CopyNumber Variation_37567 (DGV)
7 143,905,946 144,059,816 CopyNumber Variation_0726 (DGV), Variation_2110 (DGV)
7 143,910,318 143,961,876 CopyNumber Variation_82238 (DGV)
7 143,910,426 143,961,876 CopyNumber Variation_94938 (DGV)
7 143,945,278 143,999,781 Inversion Variation_59845 (DGV)
7 143,947,032 144,038,091 Inversion Variation_37283 (DGV)
7 143,951,590 143,963,081 CopyNumber Variation_70060 (DGV)
7 143,952,454 143,961,876 CopyNumber Variation_82243 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T239S % Freq CORP
1 T 99.23 0.997
2 S 0.77 0.999