Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2AE1 Olfactory Receptor

Gene Symbol OR2AE11 (View this gene in GeneCards)
Family 2
Subfamily AE
Pseudogene No
CORP pseudogene probability score 0.62 (pseudogene)
Aliases HsOR7.4.1, ORL3171
External Ids HGNC: 15087   GeneBank: AB065478, NM_001005276, XM_499460   ORDB: ORL3171   
Build #39 labels OR2AE1
Chromosomal location 7:99,876,065-99,877,033 (-)
Cluster 7@99
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2M2 51.99% 302
OR2M5 51.66% 302
OR2M7 51.32% 302

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2AE1 84% 322
Chimp CONTIG965.35-7934 98% 323
Mouse Or2t26 54% 306
Rat Or2ae2-ps 71% 286
Cow OR2AE1 84% 290

Expression evidences

Source Accession
ESTs DT932730
mRNA BC137376
GNF Atlas2 gnf1h11267_at

Sequence information

Nucleotide sequence ATGTGGCAGAAGAATCAGACCTCTCTGGCAGACTTCATCCTTGAGGGGCTCTTCGATGAC
TCCCTTACCCACCTTTTCCTTTTCTCCTTGACCATGGTGGTCTTCCTTATTGCGGTGAGT
GGCAACACCCTCACCATTCTCCTCATCTGCATTGATCCCCAGCTTCATACACCAATGTAT
TTCCTGCTCAGCCAGCTCTCCCTCATGGATCTGATGCATGTCTCCACAATCATCCTGAAG
ATGGCTACCAACTACCTATCTGGCAAGAAATCTATCTCCTTTGTGGGCTGTGCAACCCAG
CACTTCCTCTATTTGTGTCTAGGTGGTGCTGAATGTTTTCTCTTAGCTGTCATGTCCTAT
GACCGCTATGTTGCCATCTGTCATCCACTGCGCTATGCTGTGCTCATGAACAAGAAGGTG
GGACTGATGATGGCTGTCATGTCATGGTTGGGGGCATCCGTGAACTCCCTAATTCACATG
GCGATCTTGATGCACTTCCCTTTCTGTGGGCCTCGGAAAGTCTACCACTTCTACTGTGAG
TTCCCAGCTGTTGTGAAGTTGGTATGTGGCGACATCACTGTGTATGAGACCACAGTGTAC
ATCAGCAGCATTCTCCTCCTCCTCCCCATCTTCCTGATTTCTACATCCTATGTCTTCATC
CTTCAAAGTGTCATTCAGATGCGCTCATCTGGGAGCAAGAGAAATGCCTTTGCCACTTGT
GGCTCCCACCTCACGGTGGTTTCTCTTTGGTTTGGTGCCTGCATCTTCTCCTACATGAGA
CCCAGGTCCCAGTGCACTCTATTGCAGAACAAAGTTGGTTCTGTGTTCTACAGCATCATT
ACGCCCACATTGAATTCTCTGATTTATACTCTCCGGAATAAAGATGTAGCTAAGGCTCTG
AGAAGAGTGCTGAGGAGAGATGTTATCACCCAGTGCATTCAACGACTGCAATTGTGGTTG
CCCCGAGTG
Conceptual translation MWQKNQTSLADFILEGLFDDSLTHLFLFSLTMVVFLIAVSGNTLTILLICIDPQLHTPMY
FLLSQLSLMDLMHVSTIILKMATNYLSGKKSISFVGCATQHFLYLCLGGAECFLLAVMSY
DRYVAICHPLRYAVLMNKKVGLMMAVMSWLGASVNSLIHMAILMHFPFCGPRKVYHFYCE
FPAVVKLVCGDITVYETTVYISSILLLLPIFLISTSYVFILQSVIQMRSSGSKRNAFATC
GSHLTVVSLWFGACIFSYMRPRSQCTLLQNKVGSVFYSIITPTLNSLIYTLRNKDVAKAL
RRVLRRDVITQCIQRLQLWLPRV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
7 100 -100 NS A/G S/P 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
7 99,473,801 99,473,801 NS A/G S/P rs73403577 (DbSNP)
7 99,473,858 99,473,858 NS C/G V/L rs17161997 (DbSNP)
7 99,474,007 99,474,007 NS C/T C/Y rs60737583 (DbSNP)
7 99,474,195 99,474,195 SYN A/C V/V rs62474462 (DbSNP)
7 99,474,373 99,474,373 NS G/A A/V rs2164225 (DbSNP)
7 99,474,427 99,474,427 NS G/A T/I rs2572023 (DbSNP)
7 99,876,235 99,876,235 NS G/C L/V 1000GP (CEU)
7 99,876,804 99,876,804 NS A/G I/T 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
7 99,471,688 99,474,756 CopyNumber #42 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S286P L267V Y217C S214F R172W P167T I77T % Freq CORP
1 S L Y S R P I 45.85 0.840
2 S L Y S R P T 33.03 0.840
3 S V Y S R P T 12.98 0.840
4 P L C S R P T 5.45 1.000
5 P L C S W T T 1.38 1.000
6 P L C S W P T 0.61 1.000
7 S L Y F R P T 0.54 0.840
8 S V Y S R P I 0.08 0.840
9 S L Y S W P I 0.08 0.840