Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2AG1 Olfactory Receptor

Gene Symbol OR2AG11 (View this gene in GeneCards)
Family 2
Subfamily AG
Pseudogene No
CORP pseudogene probability score
Aliases OR11-79, HsOR11.4.2, ORL3281, ORL3387
External Ids HGNC: 15142   GeneBank: AB065823, AF399618, BK004295, NM_001004489   ORDB: ORL3281, ORL3387   
Build #39 labels OR2AG1, OR2AG3
Chromosomal location 11:6,785,038-6,785,985 (+)
Cluster 11@7
Synteny CLIC#24
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs11826041)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2AG2 87.03% 316

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2AG1D 83% 309
Dog OR2AG1 82% 315
Dog OR2AG1C 81% 315
Dog OR2AG2C 81% 315
Dog OR2AG2 81% 315
Chimp CONTIG784.16-15042 98% 316
Mouse Or2ag1 83% 316
Mouse Or2ag2b 80% 316
Mouse Or2ag18 80% 315
Mouse Or2ag2 80% 316
Rat Or2ag1 83% 316
Cow OR2AG1 85% 314
Cow OR2AG1E 83% 310
Cow OR2AG1FP 83% 309
Cow OR2AG2 83% 310

Expression evidences

Source Accession
mRNA BC151143
GNF Atlas2 gnf1h10947_at

Sequence information

Nucleotide sequence ATGGAGCTCTGGAACTTCACCTTGGGAAGTGGCTTCATTTTGGTGGGGATTCTGAATGAC
AGTGGGTCTCCTGAACTGCTCTGTGCTACAATTACAATCCTATACTTGTTGGCCCTGATC
AGCAATGGCCTACTGCTCCTGGCTATCACCATGGAAGCCCGGCTCCACATGCCCATGTAC
CTCCTGCTTGGGCAGCTCTCTCTCATGGACCTCCTGTTCACATCTGTTGTCACTCCCAAG
GCCCTTGCGGACTTTCTGCGCAGAGAAAACACCATCTCCTTTGGAGGCTGTGCCCTTCAG
ATGTTCCTGGCACTGACAATGGGTGGTGCTGAGGACCTCCTACTGGCCTTCATGGCCTAT
GACAGGTATGTGGCCATTTGTCATCCTCTGACATACATGACCCTCATGAGCTCAAGAGCC
TGCTGGCTCATGGTGGCCACGTCCTGGATCCTGGCATCCCTAAGTGCCCTAATATATACC
GTGTATACCATGCACTATCCCTTCTGCAGGGCCCAGGAGATCAGGCATCTTCTCTGTGAG
ATCCCACACTTGCTGAAGGTGGCCTGTGCTGATACCTCCAGATATGAGCTCATGGTATAT
GTGATGGGTGTGACCTTCCTGATTCCCTCTCTTGCTGCTATACTGGCCTCCTATACACAA
ATTCTACTCACTGTGCTCCATATGCCATCAAATGAGGGGAGGAAGAAAGCCCTTGTCACC
TGCTCTTCCCACCTGACTGTGGTTGGGATGTTCTATGGAGCTGCCACATTCATGTATGTC
TTGCCCAGTTCCTTCCACAGCACCAGACAAGACAACATCATCTCTGTTTTCTACACAATT
GTCACTCCAGCCCTGAATCCACTCATCTACAGCCTGAGGAATAAGGAGGTCATGCGGGCC
TTGAGGAGGGTCCTGGGAAAATACATGCTGCCAGCACACTCCACGCTC
Conceptual translation MELWNFTLGSGFILVGILNDSGSPELLCATITILYLLALISNGLLLLAITMEARLHMPMY
LLLGQLSLMDLLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGGAEDLLLAFMAY
DRYVAICHPLTYMTLMSSRACWLMVATSWILASLSALIYTVYTMHYPFCRAQEIRHLLCE
IPHLLKVACADTSRYELMVYVMGVTFLIPSLAAILASYTQILLTVLHMPSNEGRKKALVT
CSSHLTVVGMFYGAATFMYVLPSSFHSTRQDNIISVFYTIVTPALNPLIYSLRNKEVMRA
LRRVLGKYMLPAHSTL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 6,806,816 6,806,816 NS A/C H/P rs74057920 (DbSNP)
11 6,806,393 6,806,393 NS A/G N/S rs11826041 (DbSNP)
11 6,806,671 6,806,671 NS C/G L/V rs74057919 (DbSNP)
11 6,806,827 6,806,827 NS T/G L/V rs2659880 (DbSNP)
11 6,807,163 6,807,163 SYN A/C/G R/R rs2659879 (DbSNP)
11 6,806,610 6,806,610 SYN A/G L/L rs74057918 (DbSNP)
11 6,806,496 6,806,496 SYN C/T V/V rs11041022 (DbSNP)
11 6,807,216 6,807,216 SYN C/T L/L rs74057921 (DbSNP)
11 6,785,596 6,785,596 NS G/T V/L 1000GP (CEU, CHBJPT)
11 100 -100 NS A/G N/S 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN / L/L 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

N42S Q65H L114P L135V C141S H183P V187L I221N P262T % Freq CORP
1 N Q L L C H V I P 72.81 0.121
2 N Q L L C H L I P 20.74 0.118
3 S Q P L C H V I P 2.15 1.000
4 N Q L V C P L I P 1.61 0.118
5 S Q P L C H V I T 1.08 1.000
6 S H P L C H V I P 0.46 1.000
7 N Q L L S H V I P 0.46 0.121
8 S Q L L C H V I P 0.23 1.000
9 N Q L L C H V N P 0.23 0.121
10 N Q P L C H L I P 0.15 0.266
11 N Q L L C P L I P 0.08 0.118

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2AG1.aApr07-unspliced main_exon CDS chr11 6,785,038 6,785,985 +
3UTR chr11 6,785,985 6,785,988 +