Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2AG2 Olfactory Receptor

Gene Symbol OR2AG21 (View this gene in GeneCards)
Family 2
Subfamily AG
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR11-76, HsOR11.4.1
External Ids HGNC: 15143   GeneBank: AB065539, AF399487, BK004747, NM_001004490   
Build #39 labels OR2AG2P
Chromosomal location 11:6,768,010-6,768,957 (-)
Cluster 11@7
Synteny CLIC#24
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2AG1 87.03% 316

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2AG1 82% 315
Dog OR2AG2 82% 315
Dog OR2AG1C 81% 315
Dog OR2AG2C 81% 315
Dog OR2AG1D 81% 309
Chimp CONTIG784.16-15042 87% 316
Chimp CONTIG122669.1-90 96% 188
Mouse Or2ag2 82% 316
Mouse Or2ag2b 80% 316
Rat Or2ag2 80% 316
Cow OR2AG1 82% 314
Cow OR2AG2 83% 310
Cow OR2AG1E 81% 310

Expression evidences

Source Accession
ESTs EG357714
mRNA BC140734

Sequence information

Nucleotide sequence ATGGAGCTCCGGAACTCCACCTTGGGAAGCGGCTTCATCTTGGTGGGGATTCTGAATGAC
AGTGGGTCTCCTGAACTGCTCTATGCTACATTTACAATCCTATACATGTTGGCACTGACC
AGCAATGGTCTGCTGCTCCTGGCCATCACCATAGAAGCCCGGCTCCACATGCCCATGTAC
CTCCTGCTTGGGCAGCTCTCTCTCATGGACCTCCTGTTCACATCTGTTGTCACTCCCAAG
GCCCTTGCGGACTTTCTGCGCAGAGAAAACACTATCTCCTTTGGAGGCTGTGCACTTCAG
ATGTTCCTGGCACTGACAATGGGTAGCGCTGAGGACCTCCTACTGGCCTTCATGGCCTAT
GACAGGTATGTGGCCATTTGTCATCCTCTGAAATACATGACCCTCATGAGCCCAAGAGTC
TGCTGGATCATGGTGGCCACATCCTGGATCCTGGCATCCCTGATTGCTATAGGACATACC
ATGTACACTATGCACCTCCCTTTCTGTGTGTCCTGGGAAATCAGGCATCTGCTCTGTGAG
ATCCCACCCTTGCTGAAGTTGGCCTGTGCTGATACCTCCAGGTATGAGCTTATAATATAC
GTGACAGGTGTGACTTTCCTCTTGCTCCCCATTTCTGCCATTGTGGCCTCCTACACACTA
GTCCTATTCACTGTGCTTCGTATGCCATCAAATGAGGGGAGGAAGAAAGCCCTTGTCACC
TGCTCTTCCCACCTGATTGTGGTCGGGATGTTCTATGGAGCTGCCACATTCATGTATGTC
TTGCCCAGTTCCTTCCACAGCCCCAAACAAGACAACATCATCTCTGTTTTCTACACAATT
GTCACTCCAGCCCTGAATCCACTCATCTACAGCCTGAGGAATAAGGAGGTCATGCGGGCC
TTGAGGAGGGTCCTGGGAAAATACATACTGCTGGCACATTCCACGCTC
Conceptual translation MELRNSTLGSGFILVGILNDSGSPELLYATFTILYMLALTSNGLLLLAITIEARLHMPMY
LLLGQLSLMDLLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGSAEDLLLAFMAY
DRYVAICHPLKYMTLMSPRVCWIMVATSWILASLIAIGHTMYTMHLPFCVSWEIRHLLCE
IPPLLKLACADTSRYELIIYVTGVTFLLLPISAIVASYTLVLFTVLRMPSNEGRKKALVT
CSSHLIVVGMFYGAATFMYVLPSSFHSPKQDNIISVFYTIVTPALNPLIYSLRNKEVMRA
LRRVLGKYILLAHSTL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 6,789,251 6,789,250 Ins(1) -/A rs35806826 (DbSNP)
11 6,789,929 6,789,929 NS A/C L/R rs11828782 (DbSNP)
11 6,790,028 6,790,028 NS C/G R/P rs10839616 (DbSNP)
11 6,789,294 6,789,294 NS C/G G/R rs7924459 (DbSNP)
11 6,790,106 6,790,106 NS C/T C/Y rs7102536 (DbSNP)
11 6,768,875 6,768,875 NS T/C Y/C 1000GP (CEU, CHBJPT)
11 6,768,797 6,768,797 NS C/G R/P 1000GP (CEU, CHBJPT)
11 6,768,013 6,768,013 SYN C/T T/T 1000GP (CHBJPT)
11 6,768,698 6,768,698 NS C/A R/L 1000GP (CHBJPT)
11 100 -100 SYN T/C G/G 1000GP (YRI, YRI)
11 100 -100 NS C/A R/L 1000GP (YRI, YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R299G R87L R54P Y28C % Freq CORP
1 R R R C 31.95 0.118
2 R L R C 23.12 0.118
3 G R P C 15.98 0.118
4 R R R Y 13.21 0.118
5 R R P C 9.68 0.118
6 G R R C 5.61 0.118
7 G L R C 0.31 0.118
8 R L P C 0.08 0.118
9 R L R Y 0.08 0.118

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2AG2.aApr07-unspliced main_exon 3UTR chr11 6,767,856 6,768,010 -
CDS chr11 6,768,010 6,768,957 -