Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2AK2 Olfactory Receptor

Gene Symbol OR2AK21 (View this gene in GeneCards)
Family 2
Subfamily AK
Pseudogene No
CORP pseudogene probability score 0.07 (functional)
Aliases OR1-47, HsOR1.5.19
External Ids HGNC: 19569   GeneBank: AB065951, BK004457, NM_001004491   
Build #39 labels OR2AK2, OR2AK1P
Chromosomal location 1:247,965,377-247,966,336 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2L3 58.22% 304
OR2L8 57.89% 304
OR2T27 54.9% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2AK3 78% 284
Chimp CONTIG9387.2-1327 99% 320
Mouse Or2ak5 76% 306
Rat Or2ak5-ps 77% 306
Cow OR2AK3 78% 313

Expression evidences

Source Accession
ESTs CR747362
mRNA BC136816

Sequence information

Nucleotide sequence ATGAAAACAGGAAATCAAAGTTTTGGGACAGATTTTCTACTTGTTGGTCTTTTCCAATAT
GGCTGGATAAACTCTCTTCTCTTTGTCGTCATTGCCACCCTCTTTACAGTTGCTCTGACA
GGAAATATCATGCTGATCCACCTCATTCGACTGAACACCAGACTCCACACTCCAATGTAC
TTTCTGCTCAGTCAGCTCTCCATCGTTGACCTCATGTACATCTCCACCACAGTGCCCAAG
ATGGCAGTCAGCTTCCTCTCACAGAGTAAGACCATTAGATTTTTGGGCTGTGAGATTCAA
ACGTATGTGTTCTTGGCCCTTGGTGGAACTGAAGCCCTTCTCCTTGGTTTTATGTCTTAT
GATCGCTATGTAGCTATCTGTCACCCTTTACATTATCCTATGCTTATGAGCAAGAAGATC
TGCTGCCTCATGGTTGCATGTGCATGGGCCAGTGGTTCTATCAATGCTTTCATACATACA
TTGTATGTGTTTCAGCTTCCATTCTGTAGGTCTCGGCTCATTAACCACTTTTTCTGTGAA
GTTCCAGCTCTACTATCATTGGTGTGTCAGGACACCTCCCAGTATGAGTATACAGTCCTC
CTGAGTGGACTTATTATCTTGCTACTACCATTCCTAGCCATTCTGGCTTCCTATGCTCGT
GTGCTTATTGTGGTATTCCAGATGAGCTCAGGAAAAGGACAGGCAAAAGCTGTTTCCACT
TGTTCCTCCCACCTGATTGTGGCAAGCCTGTTCTATGCAACCACTCTCTTTACCTACACA
AGGCCACACTCCTTGCGTTCCCCTTCACGGGATAAGGCGGTGGCAGTATTTTACACCATT
GTCACACCTCTACTGAACCCATTTATCTACAGCCTGAGAAATAAGGAAGTGACGGGGGCA
GTGAGGAGACTGTTGGGATATTGGATATGCTGTAGAAAATATGACTTCAGATCTCTGTAT
Conceptual translation MKTGNQSFGTDFLLVGLFQYGWINSLLFVVIATLFTVALTGNIMLIHLIRLNTRLHTPMY
FLLSQLSIVDLMYISTTVPKMAVSFLSQSKTIRFLGCEIQTYVFLALGGTEALLLGFMSY
DRYVAICHPLHYPMLMSKKICCLMVACAWASGSINAFIHTLYVFQLPFCRSRLINHFFCE
VPALLSLVCQDTSQYEYTVLLSGLIILLLPFLAILASYARVLIVVFQMSSGKGQAKAVST
CSSHLIVASLFYATTLFTYTRPHSLRSPSRDKAVAVFYTIVTPLLNPFIYSLRNKEVTGA
VRRLLGYWICCRKYDFRSLY

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS T/C V/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN G/T L/L 1000GP (YRI, YRI, YRI, YRI, YRI)
1 247,965,420 247,965,420 NS T/C V/A 1000GP (CEU, CHBJPT)
1 247,965,627 247,965,627 NS G/A S/N 1000GP (CEU, CHBJPT)
1 247,965,718 247,965,718 SYN C/T L/L 1000GP (CEU, CHBJPT)
1 247,965,865 247,965,865 SYN G/A V/V 1000GP (CEU)
1 247,965,938 247,965,938 NS G/A V/M 1000GP (CEU, CHBJPT)
1 247,966,184 247,966,184 NS C/T R/W 1000GP (CEU, CHBJPT)
1 248,128,722 248,128,722 NS C/T A/V rs41304159 (DbSNP)
1 248,128,725 248,128,725 NS A/G D/G rs74153215 (DbSNP)
1 248,128,929 248,128,929 NS A/G N/S rs6664332 (DbSNP)
1 248,128,981 248,128,981 SYN A/G T/T rs74153216 (DbSNP)
1 248,129,020 248,129,020 SYN C/T L/L rs41308168 (DbSNP)
1 248,129,167 248,129,167 SYN A/G V/V rs41308166 (DbSNP)
1 248,129,173 248,129,173 SYN A/G Q/Q rs74153217 (DbSNP)
1 248,129,195 248,129,195 NS C/T L/F rs74153218 (DbSNP)
1 248,129,240 248,129,240 NS A/G M/V rs4478844 (DbSNP)
1 248,129,302 248,129,302 SYN A/G L/L rs74153219 (DbSNP)
1 248,129,486 248,129,486 NS C/T R/W rs74153220 (DbSNP)
1 248,129,501 248,129,501 NS A/G T/A rs74153221 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 247,849,473 248,277,638 CopyNumber Variation_48302 (DGV)
1 247,849,473 248,285,441 CopyNumber Variation_48303 (DGV)
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,128,962 248,129,289 InDel Variation_33212 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V15A G16D S84N Y102F T160A L173F V188M R270W A275T % Freq CORP
1 V G S Y T L M R A 43.01 0.177
2 V G N Y T L V R A 31.11 0.177
3 V G S Y T L V R A 20.28 0.177
4 A G N Y T L V W A 3.30 0.177
5 V G N Y T L V W A 1.00 0.177
6 V D N Y T F V R T 0.54 0.177
7 V G S F T L V R A 0.46 0.177
8 V G N Y T L M R A 0.15 0.177
9 A G S Y T L M W A 0.08 0.177
10 V G S Y A L M R A 0.08 0.177

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2AK2.aApr07-unspliced main_exon 5UTR chr1 247,965,332 247,965,377 +
CDS chr1 247,965,377 247,966,336 +
3UTR chr1 247,966,336 247,966,339 +