Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2AO1P Olfactory Receptor

Gene Symbol OR2AO1P1 (View this gene in GeneCards)
Family 2
Subfamily AO
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR7.6.18P
External Ids HGNC: 31247   GeneBank: NG_004409   
Build #39 labels
Chromosomal location 7:144,176,740-144,177,516 (+)
Cluster 7@144
Synteny CLIC#16
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2A13P 43.78% 217
OR2A5 51.66% 151

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2A13 62% 129
Mouse Or2a52 57% 129
Rat Or2a52 61% 129
Cow OR2A13 60% 129
Orang OR2BQ1P 90% 128
Horse OR2A5 57% 129
Chimp OR2A13 61% 129

Sequence information

Nucleotide sequence ATGGGAGGCAAGCAGCCCTGGGTCACAGAATTCATCCTGGTGGGATTCCAGCTCTGTGCA
GAGATGGAGATCTTTCTCTCTTGCATCTTCTCGCGATTTTATGCCTTCAGTCTACTGAGG
AATGGCATGAACATGGGACTCACCTATCTGGATGACAGAGACGACAGACTACACACCCTC
ATATACATTTTCCTCTCACACCTGGCCATCAATGACATGTACTATGCTTCCAACAATGTT
CCAAAGAGGCAGGTGAACCAAATGAACCAGAAAAAAAAAACTTTGTTCTATGGATAAAGC
AGATATTTTTGTATTTGGCTTTTGCTCACACAGAGTGCCTAATTTAGGCAATGATGTCCT
GTAATAGATATGTGGCAATCTGCTAGATCTTTCTCCAACCCTTTACGTTGAGCCTATGGG
TGTTGTTATGTGTGAGATGAGTCTCTTGAATATGGTAGACAGATGGGTCTTATTTTTTTA
ATGCAAATTATCACTCTGTGCCATTTAAGTAGGCAATTAATCCACAGTTAATATTGGTAT
GTGAGGATTTGATCCTGTCATGAAGATGTTAACTGGTTGCTTTGTGGTTTCTATTGTGTA
GTTGCTTTACAGAATCTGTGGGCTATGTACTTAAGTGTGTTTTTGTAGTAGAAGACATCA
TTCTTTTGTTTCCATGTTTAGAGCTCCCTTAAGGGTCTCTTGTAAACCCCGTCTAGTGGT
AACACTTTCCCTTAGCACTTGCTTGTCTGGGAAAGATTTTATTTTTCCTTCATTTAT
Conceptual translation MGGKQPWVTEFILVGFQLCAEMEIFLSCIFSRFYAFSLLRNGMNMGLTYLDDRDDRLHTL
IYIFLSHLAINDMYYASNNVPKRQVNQMNQKKKTLFYGXMQIFLYLAFAHTECLIXMM
SCNRYVAICXFLQPFTLSLWVLLCVRXSXWXDGSYFFNANYHSVPFKXINPQLIL
VCEDL\CHEDVNWLLCGFYCVVALQNLWAMYLSVFLXKTSFFCFHVXSLKGLLXPS
SGNTFPXLLVWERFYFSFIY

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
7 100 -100 SNP C/T 1000GP (YRI, YRI)
7 143,874,104 143,874,103 Ins(1) -/A rs67078403 (DbSNP)
7 143,874,112 143,874,111 Ins(1) -/A rs72571583 (DbSNP)
7 143,874,113 143,874,112 Ins(1) -/A rs61696785 (DbSNP)
7 143,874,114 143,874,113 Ins(1) -/A rs66651552 (DbSNP)
7 143,874,190 143,874,190 SNP C/T rs10487624 (DbSNP)
7 143,874,482 143,874,482 mixed -/A/G rs6464583 (DbSNP)
7 144,177,097 144,177,097 SNP C/T 1000GP (CEU, CHBJPT)
7 144,177,389 144,177,389 SNP A/G 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
7 143,147,775 144,368,638 CopyNumber Variation_3708 (DGV)
7 143,217,296 144,074,520 CopyNumber Variation_32962 (DGV)
7 143,545,719 143,874,190 CopyNumber Variation_53583 (DGV)
7 143,873,733 143,876,609 CopyNumber #44 (Waszak)
7 143,873,741 144,029,792 Inversion Variation_37282 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.