Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2AP1 Olfactory Receptor

Gene Symbol OR2AP11 (View this gene in GeneCards)
Family 2
Subfamily AP
Pseudogene No
CORP pseudogene probability score 0.08 (functional)
Aliases OR12-9, HsOR12.5.24
External Ids HGNC: 15335   GeneBank: AB065868, BK004260, NG_004283   
Build #39 labels OR2AP1P
Chromosomal location 12:55,574,415-55,575,341 (+)
Cluster 12@56
Synteny CLIC#31
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6C4 80.26% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length

Expression evidences

Source Accession
ESTs BG186556
GNF Atlas2 gnf1h01630_s_at
GNF Atlas2 gnf1h10896_at

Sequence information

Nucleotide sequence ATGAAAAATAAAACCGTGTTAACTGAGTTTATCCTTCTGGGTCTAACAGATGTCCCTGAA
CTCCAGGTGGCAGTTTTCACCTTTCTTTTCCTTGCGTATTTACTCAGCATCCTTGGAAAT
CTGACTATCCTCATCCTCACCTTGCTGGACTCCCACCTTCAGACTCCCATGTATTTCTTT
CTCCGGAACTTCTCCTTCTTGGAAATTTCCTTCACAAACATCTTCATTCCAAGGGTCCTG
ATTAGCATCACAACAGGGAACAAGAGTATCAGCTTTGCTGGCTGCTTCACTCAGTATTTC
TTTGCCATGTTCCTTGGGGCTACAGAGTTTTACCTTCTGGCTGCCATGTCCTATGACCGC
TATGTGGCCATCTGCAAACCTCTGCATTACACCACCATCATGAGCAGCAGAATCTGCATC
CAGCTGATTTTCTGCTCTTGGCTGGGTGGGCTAATGGCTATTATACCAACAATCACCCTG
ATGAGTCAGCAGGACTTTTGTGCATCCAACAGACTGAATCATTACTTCTGTGACTATGAG
CCTCTTCTGGAACTCTCATGTTCAGACACAAGCCTCATAGAGAAGGTTGTCTTTCTTGTG
GCATCTGTGACCCTGGTGGTCACTCTGGTGCTAGTGATTCTCTCCTATGCATTCATTATC
AAGACTATTCTGAAGCTCCCCTCTGCCCAACAAAGGACAAAAGCCTTTTCCACATGTTCT
TCCCACATGATTGTCATCTCCCTCTCTTACGGAAGCTGCATGTTTATGTACATTAATCCC
TCTGCAAAAGAAGGGGATACATTCAACAAGGGAGTAGCTCTACTCATTACTTCAGTTGCT
CCTTTGTTGAACCCCTTTATTTACACCCTAAGGAACCAACAGGTAAAACAACCCTTCAAG
GATATGGTCAAAAAGCTTCTGAATCTT
Conceptual translation MKNKTVLTEFILLGLTDVPELQVAVFTFLFLAYLLSILGNLTILILTLLDSHLQTPMYFF
LRNFSFLEISFTNIFIPRVLISITTGNKSISFAGCFTQYFFAMFLGATEFYLLAAMSYDR
YVAICKPLHYTTIMSSRICIQLIFCSWLGGLMAIIPTITLMSQQDFCASNRLNHYFCDYE
PLLELSCSDTSLIEKVVFLVASVTLVVTLVLVILSYAFIIKTILKLPSAQQRTKAFSTCS
SHMIVISLSYGSCMFMYINPSAKEGDTFNKGVALLITSVAPLLNPFIYTLRNQQVKQPFK
DMVKKLLNL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 100 -100 NS T/C L/P 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
12 100 -100 SYN G/A K/K 1000GP (YRI, YRI)
12 55,574,500 55,574,500 NS T/C L/P 1000GP (CEU)
12 55,575,149 55,575,149 SYN C/A V/V 1000GP (CHBJPT)
12 55,575,165 55,575,165 NS G/A G/R 1000GP (CEU, CHBJPT)
12 55,968,284 55,968,284 NS C/T P/L rs62624967 (DbSNP)
12 55,968,322 55,968,322 NS A/T T/S rs62623428 (DbSNP)
12 55,968,498 55,968,498 NS C/A F/L rs1896038 (DbSNP)
12 55,968,676 55,968,676 NS C/G L/V rs56012703 (DbSNP)
12 55,968,813 55,968,813 SYN G/T L/L rs11171571 (DbSNP)
12 55,968,949 55,968,949 NS A/G R/G rs61746285 (DbSNP)
12 55,968,994 55,968,994 NS C/G H/D rs17117692 (DbSNP)
12 55,969,028 55,969,028 NS C/T T/I rs17117696 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 206 (Hasin)
12 55,832,210 56,001,052 CopyNumber Variation_4780 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L29P L67S R137K L160V S247F G251R D266H T277I % Freq CORP
1 L L R L S G D T 89.48 0.244
2 L L R L S R D T 5.45 0.244
3 L L R L S G H I 1.77 0.244
4 P L R L S R D T 1.69 0.270
5 L L R V S G D T 1.23 0.244
6 L S R L S G D T 0.15 0.244
7 L L R V F G D T 0.08 0.244
8 L L K L S G D T 0.08 0.244
9 L L R L S G D I 0.08 0.244