Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2AS1P Olfactory Receptor

Gene Symbol OR2AS1P1 (View this gene in GeneCards)
Family 2
Subfamily AS
Pseudogene Yes
CORP pseudogene probability score
Aliases ORL3060
External Ids HGNC: 15004   GeneBank: NG_004705, NG_004706   ORDB: ORL3060   
Build #39 labels OR2AS1P
Chromosomal location 1:248,549,422-248,549,903 (-)
Cluster 1@248
Synteny CLIC#5
Remarks Disrupted by MIR repeat

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2AS2P 100% 98

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2V1 51% 101
Mouse Or2av9 52% 111
Rat Or2av9 50% 111
Orang OR2T27FP 49% 102

Sequence information

Nucleotide sequence AGCCAGAATATGGGGATGAGAAAGGAACAAGCTGTCTGTGGTAGTCATCCATGATTGAGA
TGATGTGTGGACCCTGAGTCAGACTACCTGGTTCAAATGCAGGCTCTCTACTTTTTACCC
ATTTGATCTTGGCCTGTGGCTCTCTACTTCTTATCCATTTCATCTTGGACTTGTGGCCTC
TCATACCTCATCTTCCTTACAGTCCTCCATATGAAATCCCCCTAAAGTAGGAACAAAGCT
TTGGCCAACTGCTCCTCCCATCTTTCCGTGGTCTTTACTTAGGAACTGTGTGTTTAATAT
ACGTGACACAGGGTTTCTCCCACATCCCTGAGCAGAAACAAGCTGTGTCTGTATTTTGCA
CTGTACTCACCCCCATGCTAAACCCCCTCATCTACATCCTGAGAAACAAGGATGTGGTGG
GGCTCTTCAGAAAGTTCTGGGAACACATCAAGTCTCTAAACAGAACACATAAATATCAAT
GT
Conceptual translation SQNMGMRKEQA\VVVIHDXDVWTLSQTTWFKCRLSTFYPFDLGLWLSTSYPFHLGLVA
SHT/IFLTVLHMKSPXRNKALANCSSHLS/GLYLGTVCLIYVTQGFSHIPEQKQAVS
VFCTVLTPMLNPLIYILRNKDVVGLFRKFWEHIKSLNRTHKYQC

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,500,109 248,865,374 CopyNumber Variation_3340 (DGV)
1 248,522,680 249,158,239 CopyNumber Variation_8355 (DGV)
1 248,595,681 248,817,382 CopyNumber Variation_2359 (DGV)
1 248,626,918 248,830,541 Inversion Variation_37092 (DGV)
1 248,644,944 248,790,408 CopyNumber Variation_0263 (DGV)
1 248,646,428 248,728,407 Inversion Variation_59670 (DGV)
1 248,687,510 248,865,377 CopyNumber Variation_0017 (DGV)
1 248,701,948 248,877,423 CopyNumber Variation_2056 (DGV)
1 248,703,193 248,795,305 CopyNumber Variation_75000 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.