Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2AS2P Olfactory Receptor

Gene Symbol OR2AS2P1 (View this gene in GeneCards)
Family 2
Subfamily AS
Pseudogene Yes
CORP pseudogene probability score
Aliases
External Ids HGNC: 31248   
Build #39 labels
Chromosomal location 1:248,498,310-248,498,659 (+)
Cluster 1@248
Synteny CLIC#5
Remarks Disrupted by MIR repeat

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2AS1P 100% 98

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length

Sequence information

Nucleotide sequence CCTGTGGCTCTCTACTTCTTATCCATTTCATCTTGGACTTGTGGCCTCTCATACCTCATC
TTCCTTACAGTCCTCCATATGAAATCCCCCTAAAGTAGGAACAAAGCTTTGGCCAACTGC
TCCTCCCATCTTTCCGTGGTCTTTACTTAGGAACTGTGTGTTTAATATACGTGACACAGG
GTTTCTCCCACATCCCTGAGCAGAAACAAGCTGTGTCTGTATTTTGCACTGTACTCACCC
CCATGCTAAACCCCCTCATCTACATCCTGAGAAACAAGGATGTGGTGGGGCTCTTCAGAA
AGTTCTGGGAACACATCAAGTCTCTAAACAGAACACATAAATATCAATGT
Conceptual translation PVALYFLSISSWTCGLSYLIFLTVLHMKSPXRNKALANCSSHLS/GLYLGTVCLIYVT
QGFSHIPEQKQAVSVFCTVLTPMLNPLIYILRNKDVVGLFRKFWEHIKSLNRTHKYQC

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,500,109 248,865,374 CopyNumber Variation_3340 (DGV)
1 248,522,680 249,158,239 CopyNumber Variation_8355 (DGV)
1 248,595,681 248,817,382 CopyNumber Variation_2359 (DGV)
1 248,626,918 248,830,541 Inversion Variation_37092 (DGV)
1 248,644,944 248,790,408 CopyNumber Variation_0263 (DGV)
1 248,646,428 248,728,407 Inversion Variation_59670 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.