Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2B3 Olfactory Receptor

Gene Symbol OR2B31 (View this gene in GeneCards)
Family 2
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.99 (pseudogene)
Aliases OR6-4, hs6M1-1, OR6-14, dJ80I19.1, HsOR6.3.4, ORL694, ORL693
External Ids HGNC: 8238   GeneBank: AF399632, BK004436, HSA302537-HSA302546, NM_001005226   ORDB: ORL694, ORL693   
Build #39 labels OR2B3
Chromosomal location 6:29,086,310-29,087,248 (-)
Cluster 6@29
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2B2 72.64% 307
OR2B6 70.61% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2B2 77% 313
Chimp CONTIG*********** 98% 313
Mouse Or2b2 74% 313
Rat Or2b2 73% 313
Cow OR2B3 88% 313
Cow OR2B3B 88% 313

Expression evidences

Source Accession
mRNA BC136818
GNF Atlas2 gnf1h10892_at

Sequence information

Nucleotide sequence ATGAATTGGGAAAATGAGAGCTCCCCAAAAGAGTTTATACTACTTGGCTTCTCAGATAGG
GCTTGGCTACAAATGCCCCTTTTTGTGGTCCTGTTAATATCATACACAATCACCATATTT
GGCAATGTGTCCATCATGATGGTGTGCATTCTGGATCCCAAACTTCATACTCCCATGTAT
TTCTTTCTCACTAATCTCTCCATCTTAGATCTCTGCTATACCACAACTACAGTCCCTCAT
ATGTTGGTAAATATTGGTTGCAACAAAAAGACCATCAGCTATGCTGGCTGTGTGGCCCAC
CTCATCATCTTCCTGGCCCTAGGTGCTACAGAGTGTCTCCTTCTGGCTGTTATGTCCTTT
GACAGATATGTGGCTGTTTGCAGACCCCTCCACTATGTAGTCATCATGAATTATTGGTTC
TGCCTAAGGATGGCAGCCTTCTCATGGCTCATTGGTTTCGGCAACTCAGTGCTGCAGTCT
TCCTTGACTCTTAACATGCCACGCTGTGGTCACCAGGAAGTGGACCACTTTTTCTGTGAG
GTGCCTGCACTTCTCAAGTTGTCATGTGCTGACACAAAGCCTATTGAGGCTGAGCTCTTC
TTCTTTAGTGTACTAATTCTTCTAATTCCAGTGACATTGATCCTCATCTCCTATGGCTTC
ATAGCTCAAGCAGTATTAAAAATCAGGTCAGCAGAAGGACGGCAAAAAGCATTTGGGACA
TGTGGGTCCCACATGATTGTGGTGTCCCTCTTTTATGGAACAGCCATTTATATGTATCTT
CAACCACCTTCATCCACCTCTAAGGACTGGGGAAAGATGGTTTCCCTCTTCTATGGAATC
ATCACATCCATGTTGAACTCCCTCATCTACAGCCTTAGAAATAAAGATATGAAGGAGGCC
TTCAAGAGGCTGATGCCAAGAATCTTTTTCTGTAAGAAA
Conceptual translation MNWENESSPKEFILLGFSDRAWLQMPLFVVLLISYTITIFGNVSIMMVCILDPKLHTPMY
FFLTNLSILDLCYTTTTVPHMLVNIGCNKKTISYAGCVAHLIIFLALGATECLLLAVMSF
DRYVAVCRPLHYVVIMNYWFCLRMAAFSWLIGFGNSVLQSSLTLNMPRCGHQEVDHFFCE
VPALLKLSCADTKPIEAELFFFSVLILLIPVTLILISYGFIAQAVLKIRSAEGRQKAFGT
CGSHMIVVSLFYGTAIYMYLQPPSSTSKDWGKMVSLFYGIITSMLNSLIYSLRNKDMKEA
FKRLMPRIFFCKK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 29,087,137 29,087,137 NS T/A T/S 1000GP (CEU)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

D269Y T38S Y35H % Freq CORP
1 D T Y 98.58 0.996
2 D S Y 0.77 0.996
3 D T H 0.55 0.999
4 Y T Y 0.11 0.996

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2B3.aApr07-unspliced main_exon 3UTR chr6 29,086,307 29,086,310 -
CDS chr6 29,086,310 29,087,248 -