Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2B6 Olfactory Receptor

Gene Symbol OR2B61 (View this gene in GeneCards)
Family 2
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.25 (functional)
Aliases OR5-40, OR5-40, OR5-41, OR5-41, OR6-4, OR6-31, HsOR6.2.3, ORL271
External Ids HGNC: 8241   GeneBank: BK004373, NM_012367, U86270, U86271, U86275   ORDB: ORL271   
Build #39 labels OR2B6, OR2B1
Chromosomal location 6:27,957,241-27,958,179 (+)
Cluster 6@28a
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2B2 81.61% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2B2 82% 313
Mouse Or2b6 81% 313
Mouse Or2b2b 81% 313
Mouse Or2b2 81% 313
Rat Or2b2 78% 313
Cow OR2B2 82% 313
Cow OR2B2D 82% 314
Orang OR2B3 71% 288
Horse OR2B2 83% 312
Chimp OR2B2P 82% 313

Expression evidences

Source Accession
mRNA BC109251
GNF Atlas2 216522_at

Sequence information

Nucleotide sequence ATGAATTGGGTAAATGACAGCATCATACAGGAGTTTATTCTGCTGGGTTTCTCAGATCGA
CCTTGGCTGGAGTTTCCACTCCTTGTGGTCTTCTTGATTTCTTACACTGTGACCATCTTT
GGCAATCTGACCATTATTCTAGTGTCACGCCTGGACACCAAACTTCATACCCCCATGTAT
TTTTTTCTTACCAATCTATCACTCCTGGATCTTTGTTACACCACATGTACAGTCCCACAA
ATGCTAGTAAATTTATGCAGCATCAGGAAAGTAATCAGTTATCGTGGCTGTGTAGCCCAG
CTTTTCATATTTCTGGCCTTGGGGGCTACTGAATATCTTCTCCTGGCCGTCATGTCCTTT
GATAGGTTTGTAGCTATTTGTCGGCCTCTCCATTACTCAGTTATCATGCACCAGAGACTC
TGCCTCCAGTTGGCAGCTGCATCCTGGGTTACTGGTTTTAGTAACTCAGTGTGGTTGTCT
ACCCTGACTCTCCAGCTGCCACTCTGTGACCCCTATGTGATAGATCACTTTCTCTGTGAA
GTCCCTGCACTGCTCAAGTTATCTTGTGTTGAGACAACAGCAAATGAGGCTGAACTATTC
CTTGTCAGTGAGCTCTTCCATCTAATACCCCTGACACTCATCCTTATATCATATGCTTTT
ATTGTCCGAGCAGTATTGAGGATACAGTCTGCTGAAGGTCGACAAAAAGCATTTGGGACA
TGTGGTTCCCATCTAATTGTGGTGTCTCTTTTTTATAGTACAGCCGTCTCTGTGTACCTG
CAACCACCTTCGCCCAGCTCCAAGGACCAAGGAAAGATGGTTTCTCTCTTCTATGGAATC
ATTGCACCCATGCTGAATCCCCTTATATATACACTTAGGAACAAGGAGGTAAAGGAAGGC
TTTAAAAGGTTGGTTGCAAGAGTCTTCTTAATCAAGAAA
Conceptual translation MNWVNDSIIQEFILLGFSDRPWLEFPLLVVFLISYTVTIFGNLTIILVSRLDTKLHTPMY
FFLTNLSLLDLCYTTCTVPQMLVNLCSIRKVISYRGCVAQLFIFLALGATEYLLLAVMSF
DRFVAICRPLHYSVIMHQRLCLQLAAASWVTGFSNSVWLSTLTLQLPLCDPYVIDHFLCE
VPALLKLSCVETTANEAELFLVSELFHLIPLTLILISYAFIVRAVLRIQSAEGRQKAFGT
CGSHLIVVSLFYSTAVSVYLQPPSPSSKDQGKMVSLFYGIIAPMLNPLIYTLRNKEVKEG
FKRLVARVFLIKK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 27,925,367 27,925,367 NS A/G I/V rs7767176 (DbSNP)
6 27,925,827 27,925,827 NS A/G Q/R rs9380030 (DbSNP)
6 27,925,334 27,925,334 NS C/G P/A rs61739698 (DbSNP)
6 27,925,255 27,925,255 SYN A/T P/P rs55711161 (DbSNP)
6 27,925,456 27,925,456 SYN T/C A/A rs904142 (DbSNP)
6 27,957,589 27,957,589 NS G/A V/I 1000GP (CEU)
6 27,957,678 27,957,678 SYN T/C A/A 1000GP (CHBJPT)
6 27,957,735 27,957,735 NS G/C Q/H 1000GP (CHBJPT)
6 27,958,049 27,958,049 NS A/G Q/R 1000GP (CHBJPT)
6 100 -100 SYN A/T P/P 1000GP (YRI)
6 100 -100 NS G/A V/I 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V117I I126V E204V Q270R % Freq CORP
1 V I E Q 85.94 0.349
2 I I E Q 7.68 0.349
3 V I E R 4.76 0.349
4 V I V Q 1.46 0.349
5 V V V Q 0.08 0.349
6 V V E Q 0.08 0.349

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
HIST1H2BOandOR2B6.aApr07-unspliced main_exon CDS chr6 27,957,241 27,958,179 +
3UTR chr6 27,958,179 27,958,189 +
HIST1H2BOandOR2B6.bApr07 exon_5UTR chr6 27,893,425 27,893,981 +
main_exon CDS_partial chr6 27,957,999 27,958,179 +
3UTR chr6 27,958,179 27,958,322 +