Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2B8P Olfactory Receptor

Gene Symbol OR2B8P1 (View this gene in GeneCards)
Family 2
Subfamily B
Pseudogene Yes
CORP pseudogene probability score
Aliases OR6-10, hs6M1-29P, dJ313I6.4, HsOR6.2.7P
External Ids HGNC: 13968   GeneBank: AB065681, BK004815, NG_003194   
Build #39 labels OR2B8
Chromosomal location 6:28,053,231-28,054,180 (-)
Cluster 6@28a
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2B7P 61.41% 311
OR2G3 63.46% 301
OR2W6P 62.54% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2B8 82% 312
Mouse Or2y1c 64% 310
Rat Or2y1 65% 308
Cow OR2B8M 79% 317
Orang OR2Y1P 63% 312
Horse OR2B8 85% 317
Horse OR2B8D 84% 313
Horse OR2B8B 83% 313
Chimp OR2Y1 64% 311

Sequence information

Nucleotide sequence ATGTGCTAACAAAGAATGGATCAGAAAAATGGAAGTTCTTTCACTGGATTTATCCTACTG
GGTTTCTCTGACAGGCCTCAGCTGGAGCTAGTCCTCTTTGTGGTTTTTTGATCTTCTATA
TCTTCACTTTGCTGGGGAACAAAACCATCATTGTATTATCTCACTTGGACCCACATCTTC
ACAATCCTATGTATTTTTTCTTCTCCAACCTAAGCTTTTTGGATCTGTGTTACACAACCG
GCATTGTTCCACAGCTCCTGGTTAATCTCAGGGGAGCAGACAAATCAATCTCCTATGGTG
GTTGTGTAGTTCAGCTGTACATCTCTCTAGGCTTGGGATCTACAGAATGCGTTCTCTTAG
GAGTGATGGCATTTGACCGCTATGCAGCTGTTTGCAGGCCCCTCCACTACACAGTAGTCA
TGCACCCTTGTCTGTATGTGCTGATGGCTTCTACTTCATGGGTCATTGGTTTTGCCAACT
CCCTATTGCAGACGGTGCTCATCTTGCTTTTAACACTTTGTGGAAGAAATAAATTAGAAC
ACTTTCTTTGTGAGGTTCCTCCATTGCTCAAGCTTGCCTGTGTTGACACTACTATGAATG
AATCTGAACTCTTCTTTGTCAGTGTCATTATTCTTCTTGTACCTGTTGCATTAATCATAT
TCTCCTATAGTCAGATTGTCAGGGCAGTCGTGAGGATAAAGTCAGCAACAGGGCAGAGAA
AAGTGTTTGGGACATGTGGCTCCCACCTCACAGTGGTTTCCCTGTTCTACGGCACAGCTA
TCTATGCTTACCTCCAGCCCGGCAACAACTACTCTCAGGATCAGGGCAAGTTCATCTCTC
TCTTCTACACCATCATTACACCCATGATCAACCCCCTCATATATACACTGAGGAACAAGG
ATGTGAAAGGAGCACTTAAGAAGGTGCTCTGGAAGAACTACGACTCCAGA
Conceptual translation MCXRMDQKNGSSFTGFILLGFSDRPQLELVLFV/FLIFYIFTLLGNKTIIVLSHLDPH
LHNPMYFFFSNLSFLDLCYTTGIVPQLLVNLRGADKSISYGGCVVQLYISLGLGSTECVL
LGVMAFDRYAAVCRPLHYTVVMHPCLYVLMASTSWVIGFANSLLQTVLILLLTLCGRNKL
EHFLCEVPPLLKLACVDTTMNESELFFVSVIILLVPVALIIFSYSQIVRAVVRIKSATGQ
RKVFGTCGSHLTVVSLFYGTAIYAYLQPGNNYSQDQGKFISLFYTIITPMINPLIYTLRN
KDVKGALKKVLWKNYDSR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
6 28,021,256 28,021,256 SNP A/G rs203886 (DbSNP)
6 28,021,269 28,021,269 SNP C/T rs203887 (DbSNP)
6 28,021,589 28,021,589 SNP A/G rs203888 (DbSNP)
6 28,021,768 28,021,768 SNP C/T rs9468270 (DbSNP)
6 28,021,775 28,021,775 SNP G/T rs203889 (DbSNP)
6 28,021,854 28,021,853 Ins(1) -/G rs35155115 (DbSNP)
6 28,021,855 28,021,854 Ins(1) -/G rs67047506 (DbSNP)
6 28,053,482 28,053,482 SNP T/A 1000GP (CEU)
6 28,053,491 28,053,491 SNP C/T 1000GP (CEU, CHBJPT)
6 28,053,811 28,053,811 SNP G/A 1000GP (CEU, CHBJPT)
6 28,053,990 28,053,990 SNP C/T 1000GP (CEU, CHBJPT)
6 28,053,997 28,053,997 SNP T/G 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
6 28,019,009 28,022,058 Deletion #284 (Waszak)
6 28,020,282 28,022,144 CopyNumber Variation_93574 (DGV)
6 28,020,966 28,021,156 InDel Variation_93575 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.