Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2BH1P Olfactory Receptor

Gene Symbol OR2BH1P1 (View this gene in GeneCards)
Family 2
Subfamily BH
Pseudogene Yes
CORP pseudogene probability score
Aliases
External Ids HGNC: 31250   GeneBank: NG_004410   
Build #39 labels 171
Chromosomal location 11:28,986,635-28,987,498 (+)
Cluster 11@29
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2F1 33.92% 283
OR2F2 31.58% 285
OR2M2 30.5% 282

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Cow OR2AV1 40% 277
Horse OR2AV13P 41% 284

Sequence information

Nucleotide sequence ATGTTTTCTCTCTCAATTTTACAACTTCCTTAGATGTACACTGTGGCCCTCTCAGGGACA
TCTATTCTGATTTTCTTGATTTAGACAGATTTCTGAGTTCACACATCATTGTACTCTTTC
TGAGTTCTCATTGATATAGCCATTTCTGTTGTTAAAATTGGTATTGAGGTTTTCTCTGGA
AAGATAAACTTCTCACATACTGGTTGTGGAACTCAGATTTTCTTCTTTCTGACTGCTGGC
ATTTTCAAATATGTCCTTCTCACTTATATGGCTTATGACCATAACGTGGCTATCTGTGCC
TGAGTGACCAACCTTCATGAGTGATCAGGTCTTCTAGCAATGGGCAGTAGAGTCTTGGAT
TGGAGGAAAACTTTCTTCTTTGGCTCATACCATTTATATTTTTCATTTATTCAGCTATAA
AGCAAAGGAGATTAGCCACTTATGGCCCAAGCTCTTTTAAAGCTCCTCTGTGGGGATCCC
CTATATACAAAATGATGTTTTTTTCACAATAATTACATTCTTGTTCACCCTGCTTCCTCT
TACTCTGACCTTATCCTCCAAGCTTATTGTGTTCACTATCCTACACATGAACTCCTCAAA
TGGGGGAGCAAAGTCTTGGCCACATACTGCTTTCATCTGAGTGTGCTGATTCCCTGCTGT
GGCCAGGCCACTTCGTCTACATGACTTCCAGCTCCTTCTGAACTGTAAACAAATACCAGA
CCATGTCTGCTTGACAGCATAATTATATCCACGTTGAAACCCCTGATAGACATTCTGAAG
AATGCAGAAGTGGCAGGAGCTTGGAGCAAGTTCTTGTAAAAGAAAGCGCTAAAAAGTCAA
CACCTTATTATCGTAGCTGTGAAA
Conceptual translation MFSLSILQLPXYTVALSGTSILIFLIXDFXHTSLYSFXLIDIAISVVKIGIEVFSG
KINFSHTGCGTQIFFFLTAGIFKYVLLTYMAYDHNVAICAXTNL\SDQVFXWAVESW
IGGKLSSLAHTIYIFHLFSYKAKEISHLWPKLFXSSVGIPYIQNDVFFTIITFLFTLLP
LTLTLSSKLIVFTILHMNSSNGGAKSW/TYCFHLSVLIPCCGQA/FVYMTSSSFXVN
KYQTMS/LTAXYP/LKPLIDILKNAEVAGAWSKFLXKALKSQHLIIVAVK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP G/C 1000GP (YRI)
11 28,987,030 28,987,030 SNP A/G 1000GP (CHBJPT)
11 28,987,421 28,987,421 SNP G/C 1000GP (CHBJPT)
11 29,008,968 29,008,968 SNP C/G rs72638132 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
Deletion 250 (Hasin)
11 28,924,493 29,072,498 CopyNumber Variation_3841 (DGV)
11 28,987,325 29,017,486 CopyNumber Variation_34956 (DGV)
11 28,989,481 29,022,755 CopyNumber Variation_34957 (DGV)
11 29,006,385 29,013,797 CopyNumber Variation_23137 (DGV)
11 29,006,448 29,013,344 CopyNumber Variation_101171 (DGV)
11 29,006,460 29,013,278 CopyNumber Variation_22697 (DGV)
11 29,006,531 29,012,746 CopyNumber Variation_58509 (DGV)
11 29,007,041 29,013,038 CopyNumber Variation_61114 (DGV)
11 29,007,150 29,012,726 CopyNumber Variation_65906 (DGV)
11 29,007,201 29,012,896 CopyNumber Variation_43818 (DGV)
11 29,007,208 29,012,280 CopyNumber Variation_75586 (DGV), Variation_85704 (DGV)
11 29,008,082 29,011,045 Deletion #7 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.