Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2C3 Olfactory Receptor

Gene Symbol OR2C31 (View this gene in GeneCards)
Family 2
Subfamily C
Pseudogene No
CORP pseudogene probability score
Aliases OR1-30, OR1-29, HsOR1.5.3
External Ids HGNC: 15005   GeneBank: AB065649, AF399495, BK004471, BK004609   
Build #39 labels OR2C3, OR2C5P
Chromosomal location 1:247,531,552-247,532,511 (-)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2B7P 60% 305
OR2G3 58.36% 305
OR2W6P 58.03% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2C3 89% 314
Chimp CONTIG658.77-10430 98% 284
Mouse Or2w6 61% 306
Rat Or2w6 61% 305
Cow OR2C3 84% 320
Cow OR2C3B 85% 310

Expression evidences

Source Accession
ESTs EL735234
mRNA CU689001
GNF Atlas2 gnf1h03760_at

Sequence information

Nucleotide sequence ATGATGGAAATAGCCAATGTGAGTTCTCCAGAAGTCTTTGTCCTCCTGGGCTTCTCCACA
CGACCCTCACTAGAAACTGTCCTCTTCATAGTTGTCTTGAGTTTTTACATGGTATCGATC
TTGGGCAATGGCATCATCATTCTGGTCTCCCATACAGATGTGCACCTCCACACACCTATG
TACTTCTTTCTTGCCAACCTCCCCTTCCTGGACATGAGCTTCACCACGAGCATTGTCCCA
CAGCTCCTGGCTAACCTCTGGGGACCACAGAAAACCATAAGCTATGGAGGGTGTGTGGTC
CAGTTCTATATCTCCCATTGGCTGGGGGCAACCGAGTGTGTCCTGCTGGCCACCATGTCC
TATGACCGCTACGCTGCCATCTGCAGGCCACTCCATTACACTGTCATTATGCATCCACAG
CTTTGCCTTGGGCTAGCTTTGGCCTCCTGGCTGGGGGGTCTGACCACCAGCATGGTGGGC
TCCACGCTCACCATGCTCCTACCGCTGTGTGGGAACAATTGCATCGACCACTTCTTTTGC
GAGATGCCCCTCATTATGCAACTGGCTTGTGTGGATACCAGCCTCAATGAGATGGAGATG
TACCTGGCCAGCTTTGTCTTTGTTGTCCTGCCTCTGGGGCTCATCCTGGTCTCTTACGGC
CACATTGCCCGGGCCGTGTTGAAGATCAGGTCAGCAGAAGGGCGGAGAAAGGCATTCAAC
ACCTGTTCTTCCCACGTGGCTGTGGTGTCTCTGTTTTACGGGAGCATCATCTTCATGTAT
CTCCAGCCAGCCAAGAGCACCTCCCATGAGCAGGGCAAGTTCATAGCTCTGTTCTACACC
GTAGTCACTCCTGCGCTGAACCCACTTATTTACACCCTGAGGAACACGGAGGTGAAGAGC
GCCCTCCGGCACATGGTATTAGAGAACTGCTGTGGCTCTGCAGGCAAGCTGGCGCAAATT
Conceptual translation MMEIANVSSPEVFVLLGFSTRPSLETVLFIVVLSFYMVSILGNGIIILVSHTDVHLHTPM
YFFLANLPFLDMSFTTSIVPQLLANLWGPQKTISYGGCVVQFYISHWLGATECVLLATMS
YDRYAAICRPLHYTVIMHPQLCLGLALASWLGGLTTSMVGSTLTMLLPLCGNNCIDHFFC
EMPLIMQLACVDTSLNEMEMYLASFVFVVLPLGLILVSYGHIARAVLKIRSAEGRRKAFN
TCSSHVAVVSLFYGSIIFMYLQPAKSTSHEQGKFIALFYTVVTPALNPLIYTLRNTEVKS
ALRHMVLENCCGSAGKLAQI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS G/C L/V 1000GP (YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN G/A L/L 1000GP (YRI)
1 247,531,647 247,531,647 NS G/C L/V 1000GP (CEU, CHBJPT)
1 247,531,656 247,531,656 SYN G/A L/L 1000GP (CEU, CHBJPT)
1 247,532,125 247,532,125 NS C/G R/S 1000GP (CEU)
1 247,532,310 247,532,310 NS G/A P/S 1000GP (CEU, CHBJPT)
1 247,532,454 247,532,454 NS T/C T/A 1000GP (CEU, CHBJPT)
1 247,694,949 247,694,949 NS C/G V/L rs6702693 (DbSNP)
1 247,694,958 247,694,958 SYN A/G L/L rs6702695 (DbSNP)
1 247,695,283 247,695,283 NS C/G Q/H rs58515573 (DbSNP)
1 247,695,427 247,695,427 NS C/G R/S rs34220133 (DbSNP)
1 247,695,612 247,695,612 NS A/G S/P rs6657127 (DbSNP)
1 247,695,631 247,695,631 Del(1) -/G rs71570435 (DbSNP)
1 247,695,756 247,695,756 NS C/T A/T rs6697472 (DbSNP)
1 247,695,757 247,695,757 SYN G/A S/S rs61746303 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,692,854 247,695,913 Deletion #182 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L288V H176Q R128S P67S S38L I29L T19A % Freq CORP
1 L H R S S I A 75.73 0.954
2 V H R S S I A 12.44 0.954
3 L H S S S I A 7.37 0.954
4 L H R S S I T 2.38 0.954
5 L Q R S S I A 1.54 0.954
6 L H R P S I T 0.23 0.954
7 L H R S L I A 0.23 0.954
8 L H R S S L A 0.08 0.954

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2C3.aApr07 main_exon 3UTR chr1 247,530,133 247,531,552 -
CDS chr1 247,531,552 247,532,511 -
5UTR chr1 247,532,511 247,532,540 -
exon_5UTR chr1 247,533,507 247,533,840 -