Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2D2 Olfactory Receptor

Gene Symbol OR2D21 (View this gene in GeneCards)
Family 2
Subfamily D
Pseudogene No
CORP pseudogene probability score 0.22 (functional)
Aliases OR11-610, hg27, OR11-88, OR2D2, HsOR11.4.7, ORL3432, ORL483
External Ids HGNC: 8244   GeneBank: AB065824, AF065876, AF399591, BK004434, NM_003700   ORDB: ORL3432, ORL483   
Build #39 labels OR2D2, OR2D1
Chromosomal location 11:6,891,577-6,892,500 (-)
Cluster 11@7
Synteny CLIC#24
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2D3 63.84% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2D2 87% 308
Dog OR2D2C 86% 308
Chimp CONTIG784.6-11065 64% 307
Mouse Or2d2 85% 307
Rat Or2d2 85% 307
Rat Or2d2b 83% 307
Cow OR2D2 84% 308

Expression evidences

Source Accession
mRNA BC140729
GNF Atlas2 gnf1h10962_at

Sequence information

Nucleotide sequence ATGAGACAGATAAATCAGACACAAGTGACAGAATTCCTCCTTCTGGGACTCTCTGATGGG
CCACACACCGAGCAGCTGCTATTTATCGTATTATTGGGTGTCTACCTGGTCACTGTGCTT
GGAAATCTGCTTCTAATCTCCCTTGTTCATGTTGACTCCCAACTTCACACACCCATGTAT
TTTTTTCTCTGCAACTTGTCTCTGGCTGACCTCTGTTTCTCTACCAACATAGTTCCTCAG
GCACTAGTCCACCTGCTTTCCAGAAAGAAGGTCATTGCATTCACACTTTGCGCAGCTCGA
CTTCTCTTTTTCCTCATTTTTGGGTGTACCCAGTGCGCCCTTCTTGCAGTGATGTCCTAT
GATCGCTATGTTGCAATCTGCAATCCTCTGCGTTACCCTAACATCATGACCTGGAAAGTG
TGTGTCCAGCTGGCAACAGGATCATGGACCAGTGGCATTCTGGTGTCTGTGGTAGACACC
ACCTTCATACTGAGGCTACCCTACCGAGGCAGTAACAGCATTGCTCATTTCTTTTGTGAG
GCCCCTGCACTATTGATCTTAGCATCCACAGACACCCATGCATCAGAGATGGCCATTTTT
CTTATGGGGGTTGTGATTCTCCTCATACCTGTTTTTCTGATTCTGGTATCCTATGGCCGT
ATCATAGTAACTGTGGTCAAGATGAAGTCAACTGTGGGGAGTCTCAAGGCATTTTCTACC
TGTGGCTCCCACCTCATGGTGGTCATACTTTTTTATGGATCAGCAATTATCACTTACATG
ACACCCAAGTCTTCCAAACAGCAGGAAAAATCGGTGTCTGTTTTCTATGCAATAGTGACT
CCCATGCTTAATCCCCTCATCTATAGCCTGAGAAACAAGGATGTGAAGGCAGCTCTGAGG
AAAGTAGCCACAAGGAATTTCCCA
Conceptual translation MRQINQTQVTEFLLLGLSDGPHTEQLLFIVLLGVYLVTVLGNLLLISLVHVDSQLHTPMY
FFLCNLSLADLCFSTNIVPQALVHLLSRKKVIAFTLCAARLLFFLIFGCTQCALLAVMSY
DRYVAICNPLRYPNIMTWKVCVQLATGSWTSGILVSVVDTTFILRLPYRGSNSIAHFFCE
APALLILASTDTHASEMAIFLMGVVILLIPVFLILVSYGRIIVTVVKMKSTVGSLKAFST
CGSHLMVVILFYGSAIITYMTPKSSKQQEKSVSVFYAIVTPMLNPLIYSLRNKDVKAALR
KVATRNFP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 nonsense SNP G/T C/* 1000GP (YRI)
11 100 -100 NS A/G M/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 6,891,596 6,891,596 NS A/G V/A 1000GP (CEU)
11 6,891,896 6,891,896 NS A/G M/T 1000GP (CEU, CHBJPT)
11 6,892,012 6,892,012 NS T/C I/M 1000GP (CEU, CHBJPT)
11 6,892,013 6,892,013 NS A/G I/T 1000GP (CEU, CHBJPT)
11 6,892,050 6,892,050 NS T/C S/G 1000GP (CEU)
11 6,892,059 6,892,059 NS A/G S/P 1000GP (CEU, CHBJPT)
11 6,912,844 6,912,844 SYN C/T K/K rs71472615 (DbSNP)
11 6,912,925 6,912,926 Del(2) -/TT rs10566026 (DbSNP)
11 6,913,074 6,913,074 NS C/G G/R rs60116285 (DbSNP)
11 6,913,127 6,913,127 NS G/A T/M rs2741804 (DbSNP)
11 6,913,243 6,913,243 NS C/T M/I rs1965207 (DbSNP)
11 6,913,244 6,913,244 NS A/G I/T rs1965208 (DbSNP)
11 6,913,290 6,913,290 NS A/G S/P rs1965209 (DbSNP)
11 6,913,399 6,913,399 SYN C/T Q/Q rs58942970 (DbSNP)
11 6,913,482 6,913,482 NS A/G Y/H rs57896484 (DbSNP)
11 6,913,540 6,913,540 nonsense SNP G/T C/* rs16919417 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 6,910,808 6,913,831 CopyNumber #124 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R220H M202T I163M S151G S148P Y120S H84Y C64* % Freq CORP
1 R M I S S Y H C 40.32 0.492
2 R T I S S Y H C 26.27 0.492
3 R T I S P Y H C 15.05 0.492
4 R M M S S Y H C 13.13 0.492
5 R M I S S Y Y C 2.30 0.492
6 R M I S S Y H * 1.31 1.200
7 R M I S S S H C 0.84 0.492
8 H M I S S Y H C 0.46 0.492
9 R T I G S Y H C 0.31 0.492

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2D2.aApr07-unspliced main_exon 3UTR chr11 6,891,574 6,891,577 -
CDS chr11 6,891,577 6,892,500 -