Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2D3 Olfactory Receptor

Gene Symbol OR2D31 (View this gene in GeneCards)
Family 2
Subfamily D
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR11-89, HsOR11.4.8, ORL3430
External Ids HGNC: 15146   GeneBank: AB065825, AF399592, BK004294, NM_001004684   ORDB: ORL3430   
Build #39 labels OR2D3
Chromosomal location 11:6,921,050-6,921,991 (+)
Cluster 11@7
Synteny CLIC#24
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2D2 63.84% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2D3 88% 314
Dog OR2D3D 89% 314
Chimp CONTIG784.6-11065 98% 314
Mouse Or2d3b 83% 307
Mouse Or2d3 84% 304
Mouse Or2d3c 82% 307
Rat Or2d36 80% 314
Rat Or2d3 83% 307
Cow OR2D3 89% 314

Expression evidences

Source Accession
ESTs BX495865
mRNA BC137209
GNF Atlas2 gnf1h11112_at

Sequence information

Nucleotide sequence ATGGGAGAAGAAAACCAAACCTTTGTGTCCAAGTTTATCTTCCTGGGTCTTTCACAGGAC
TTGCAGACCCAGATCCTGCTATTTATCCTTTTCCTCATCATTTATCTGCTGACCGTGCTT
GGAAACCAGCTCATCATCATTCTCATCTTCCTGGATTCTCGCCTTCACACTCCCATGTAT
TTTTTTCTTAGAAATCTCTCCTTTGCAGATCTCTGTTTCTCTACTAGCATTGTCCCTCAA
GTGTTGGTTCACTTCTTGGTAAAGAGGAAAACCATTTCTTTTTATGGGTGTATGACACAG
ATAATTGTCTTTCTTCTGGTTGGGTGTACAGAGTGTGCGCTGCTGGCAGTGATGTCCTAT
GACCGGTATGTGGCTGTCTGCAAGCCCCTGTACTACTCTACCATCATGACACAACGGGTG
TGTCTCTGGCTGTCCTTCAGGTCCTGGGCCAGTGGGGCACTAGTGTCTTTAGTAGATACC
AGCTTTACTTTCCATCTTCCCTACTGGGGACAGAATATAATCAATCACTACTTTTGTGAA
CCTCCTGCCCTCCTGAAGCTGGCTTCCATAGACACTTACAGCACAGAAATGGCCATCTTT
TCAATGGGCGTGGTAATCCTCCTGGCCCCTGTCTCCCTGATTCTTGGTTCTTATTGGAAT
ATTATCTCCACTGTTATCCAGATGCAGTCTGGGGAAGGGAGACTCAAGGCTTTTTCCACC
TGTGGCTCCCATCTTATTGTTGTTGTCCTCTTCTATGGGTCAGGAATATTCACCTACATG
CGACCAAACTCCAAGACTACAAAAGAACTGGATAAAATGATATCTGTGTTCTATACAGCG
GTGACTCCAATGTTGAACCCCATAATTTATAGCTTGAGGAACAAAGATGTCAAAGGGGCT
CTCAGGAAACTAGTTGGGAGAAAGTGCTTCTCTCATAGGCAG
Conceptual translation MGEENQTFVSKFIFLGLSQDLQTQILLFILFLIIYLLTVLGNQLIIILIFLDSRLHTPMY
FFLRNLSFADLCFSTSIVPQVLVHFLVKRKTISFYGCMTQIIVFLLVGCTECALLAVMSY
DRYVAVCKPLYYSTIMTQRVCLWLSFRSWASGALVSLVDTSFTFHLPYWGQNIINHYFCE
PPALLKLASIDTYSTEMAIFSMGVVILLAPVSLILGSYWNIISTVIQMQSGEGRLKAFST
CGSHLIVVVLFYGSGIFTYMRPNSKTTKELDKMISVFYTAVTPMLNPIIYSLRNKDVKGA
LRKLVGRKCFSHRQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/A L/I 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN C/T V/V 1000GP (YRI, YRI, YRI, YRI)
11 6,921,245 6,921,245 NS C/A L/I 1000GP (CEU, CHBJPT)
11 6,921,286 6,921,286 SYN T/C P/P 1000GP (CEU)
11 6,921,358 6,921,358 SYN C/T V/V 1000GP (CEU)
11 6,921,388 6,921,388 SYN G/A A/A 1000GP (CEU)
11 6,921,397 6,921,397 SYN A/C A/A 1000GP (CEU, CHBJPT)
11 6,921,464 6,921,464 NS C/T R/W 1000GP (CEU, CHBJPT)
11 6,921,495 6,921,495 NS G/C W/S 1000GP (CEU, CHBJPT)
11 6,921,684 6,921,684 NS C/T S/F 1000GP (CEU)
11 6,921,721 6,921,721 SYN T/C T/T 1000GP (CEU, CHBJPT)
11 6,942,476 6,942,476 NS A/C I/L rs10839658 (DbSNP)
11 6,942,589 6,942,589 Del(1) -/C rs59264610 (DbSNP)
11 6,942,628 6,942,628 SYN A/C A/A rs11605995 (DbSNP)
11 6,942,695 6,942,695 NS C/T R/W rs12806437 (DbSNP)
11 6,942,726 6,942,726 NS C/G S/W rs10839659 (DbSNP)
11 6,942,952 6,942,952 SYN T/C T/T rs2035844 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T73A L82I I108T R155W S164F W165S L200F S228F M300V A316V % Freq CORP
1 T L I R S W L S M A 35.48 0.141
2 T I I R S S L S M A 28.88 0.141
3 T I I R S W L S M A 18.13 0.141
4 T L I W S W L S M A 12.60 0.141
5 T L I R F W L S M A 2.46 0.141
6 T L I R F W L S M V 0.92 0.141
7 T I I R S W F S M A 0.38 0.141
8 T L I R S W L S V A 0.38 0.141
9 T L I R S S L S M A 0.23 0.141
10 T L T W S W L S M A 0.23 0.141
11 T I I R S S L F M A 0.15 0.141
12 A L I R S W L S M A 0.08 0.141
13 T L I W S S L S M A 0.08 0.141

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2D3.aApr07-unspliced main_exon 5UTR chr11 6,921,002 6,921,050 +
CDS chr11 6,921,050 6,921,991 +
3UTR chr11 6,921,991 6,921,994 +