Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2E1P Olfactory Receptor

Gene Symbol OR2E1P1 (View this gene in GeneCards)
Family 2
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases hs6M1-9, HS29K1, HSNH0569I24, HsOR6.2.9P, ORL3169
External Ids HGNC: 15507   GeneBank: NG_004088   ORDB: ORL3169   
Build #39 labels OR2E1P
Chromosomal location 6:28,455,638-28,456,111 (-)
Cluster 6@28b
Synteny CLIC#12
Remarks Disrupted by LTR repeat

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2B11 52.29% 153
OR2B4P 51.59% 157
OR2N1P 50.65% 154

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2B28P 69% 157
Mouse Or2b28 82% 154
Rat Or2b11 56% 153
Cow OR2B28 81% 154
Orang OR2C1 54% 154
Horse OR2B28 80% 154
Chimp OR2B11 53% 153

Sequence information

Nucleotide sequence ATGGGCTTTGTCAAATATCCATGGCTGGATTTTCTTCTCTTCTGTGTCCTCTTGACCTTC
TACATGTTCACATTGTTGGGAAATAGTGCTATTATTCTGGTCTCTCAACTAGATTCCCAA
CTTCATAGTCCTATGTATTTCCTTCTCACCAGTCTTTCCGTCTTATATCTCTGTTTCACC
ACCACAACAGTACCTCAAATGCTGTTCAATTTAGGGGGCCCAACAAGAACATCACTTAAA
TAGGCTGTATGGCCCAGGCCTATGTATTTCACTGGCTAGCCTGTATTGAATGTGTCCTTC
TTGGCATCGTGGCCTTAGACTGCTATGTGGCTGTCTGTAAGCCTCCAAGGTACACTATAA
TCATAGACCATAAGGTCTGCCTGCACCTGTCCAGCACTGCTTGGCTAATTGGTCTGGCCA
ATTCACTGCTGCAGTCAACAATCACAATTCAGTTGCCCCTGTAGAGGTGTATAG
Conceptual translation MGFVKYPWLDFLLFCVLLTFYMFTLLGNSAIILVSQLDSQLHSPMYFLLTSLSVLYLCFT
TTTVPQMLFNLGG/NKNITXGCMAQAYVFHWLACIECVLLGIVALDCYVAVCKPPRYT
IIIDHKVCLHLSSTAWLIGLANSLLQSTITIQLPLXCI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
6 28,423,510 28,423,510 SNP C/T rs2859370 (DbSNP)
6 28,423,599 28,423,599 SNP C/T rs7766749 (DbSNP)
6 28,423,603 28,423,603 SNP A/G rs2531811 (DbSNP)
6 28,423,880 28,423,880 SNP A/G rs73740627 (DbSNP)
6 28,455,733 28,455,733 SNP C/T 1000GP (CEU, CHBJPT)
6 28,455,822 28,455,822 SNP T/C 1000GP (CEU)
6 28,455,826 28,455,826 SNP A/G 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.