Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2F1 Olfactory Receptor

Gene Symbol OR2F11 (View this gene in GeneCards)
Family 2
Subfamily F
Pseudogene No
CORP pseudogene probability score
Aliases OR7-139, OR7-139, OR7-140, OR7-140, OR14-60, OR7-7, OLF3, HsOR7.6.7, ORL166
External Ids HGNC: 8246   GeneBank: AF399594, BK004215, HSU56421, NM_012369, U86228, U86279, U86280   ORDB: ORL166   
Build #39 labels OR2F1, OR2F3
Chromosomal location 7:143,959,971-143,960,921 (+)
Cluster 7@144
Synteny CLIC#16
Remarks Segregating Pseudo Gene, a polymorphism in a highly conserved amino-acid (rs2072164)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2F2 90.22% 317

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2F1 86% 317
Dog OR2F2 87% 317
Dog OR2F1D 87% 317
Dog OR2F1C 85% 317
Chimp CONTIG646.123-4742 98% 309
Mouse Or2f1 87% 317
Mouse Or2f2 85% 317
Rat Or2f2 85% 317
Rat Or2f1b 84% 317
Cow OR2F1 87% 316
Cow OR2F2 86% 317
Cow OR2F2B 86% 317
Cow OR2F1D 85% 317

Expression evidences

Source Accession
mRNA BC104975
GNF Atlas2 208525_s_at
GNF Atlas2 208526_at

Sequence information

Nucleotide sequence ATGGGAACAGATAACCAGACTTGGGTGAGTGAATTTATTCTCCTCGGCCTGTCCAGTGAC
TGGGACACTCGGGTCTCCCTGTTTGTCCTGTTCTTGGTCATGTATGTGGTGACCGTGCTG
GGGAACTGTCTCATTGTCCTTCTGATCAGACTGGACAGCCGACTCCACACTCCCATGTAT
TTCTTTCTCACCAACCTCTCCCTTGTCGATGTCTCCTATGCCACAAGTGTAGTCCCTCAG
CTGCTGGCACATTTTCTTGCAGAACATAAAGCCATCCCATTCCAGAGCTGTGCAGCCCAG
TTATTTTTCTCCCTGGCCTTGGGTGGGATTGAGTTTGTTCTCCTGGCGGTGATGGCCTAT
GACCGCTATGTGGCTGTGTGTGATGCCCTGCGATACTCGGCCATCATGCATGGAGGGCTG
TGTGCTAGGTTGGCCATCACATCCTGGGTCAGTGGCTTCATCAGCTCTCCTGTGCAGACT
GCTATCACCTTTCAGCTGCCCATGTGCAGAAACAAGTTTATTGATCACATATCCTGTGAA
CTCCTAGCTGTGGTCAGGCTGGCTTGTGTGGACACCTCCTCCAATGAGGTCACCATCATG
GTGTCTAGCATTGTTCTTCTGATGACACCCTTCTGCCTGGTTCTTTTGTCCTACATCCAG
ATCATCTCCACCATCCTAAAGATCCAGTCCAGAGAAGGAAGAAAGAAAGCTTTCCACACG
TGTGCCTCTCACCTCACAGTGGTTGCCCTGTGCTATGGTGTGGCCATTTTCACTTACATC
CAGCCCCACTCCAGTCCCTCTGTCCTTCAGGAGAAGTTGTTCTCTGTCTTTTATGCCATT
TTAACACCAATGCTGAACCCCATGATTTACAGCCTAAGGAATAAAGAGGTGAAGGGGGCC
TGGCAGAAACTATTATGGAAATTCTCTGGGTTAACATCAAAGCTGGCAACT
Conceptual translation MGTDNQTWVSEFILLGLSSDWDTRVSLFVLFLVMYVVTVLGNCLIVLLIRLDSRLHTPMY
FFLTNLSLVDVSYATSVVPQLLAHFLAEHKAIPFQSCAAQLFFSLALGGIEFVLLAVMAY
DRYVAVCDALRYSAIMHGGLCARLAITSWVSGFISSPVQTAITFQLPMCRNKFIDHISCE
LLAVVRLACVDTSSNEVTIMVSSIVLLMTPFCLVLLSYIQIISTILKIQSREGRKKAFHT
CASHLTVVALCYGVAIFTYIQPHSSPSVLQEKLFSVFYAILTPMLNPMIYSLRNKEVKGA
WQKLLWKFSGLTSKLAT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
7 143,657,473 143,657,473 NS A/G H/R rs2072165 (DbSNP)
7 143,657,232 143,657,232 NS A/G T/A rs73464587 (DbSNP)
7 143,657,573 143,657,573 NS A/T R/S rs61731396 (DbSNP)
7 143,657,782 143,657,782 NS C/T T/M rs73464588 (DbSNP)
7 143,657,427 143,657,427 NS C/T R/C rs2072164 (DbSNP)
7 143,657,801 143,657,801 SYN A/G T/T rs2072166 (DbSNP)
7 143,960,334 143,960,334 NS C/T R/C 1000GP (CEU, CHBJPT)
7 143,960,708 143,960,708 SYN A/G T/T 1000GP (CEU, CHBJPT)
7 100 -100 NS C/T R/C 1000GP (YRI, YRI)
7 100 -100 SYN A/G T/T 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
7 143,615,165 143,744,519 CopyNumber Variation_0110 (DGV)
7 143,147,775 144,368,638 CopyNumber Variation_3708 (DGV)
7 143,208,034 143,736,035 CopyNumber Variation_5247 (DGV)
7 143,572,286 143,866,532 CopyNumber Variation_8581 (DGV)
7 143,217,296 144,074,520 CopyNumber Variation_32962 (DGV)
7 143,545,719 143,874,190 CopyNumber Variation_53583 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R122C H137R I162V % Freq CORP
1 R H I 77.80 0.612
2 R R I 10.98 0.612
3 C R I 9.83 0.966
4 C H I 1.08 0.966
5 R H V 0.31 0.612

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2F1.aApr07-unspliced main_exon 5UTR chr7 143,959,641 143,959,971 +
CDS chr7 143,959,971 143,960,921 +
3UTR chr7 143,960,921 143,961,015 +