Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2F2 Olfactory Receptor

Gene Symbol OR2F21 (View this gene in GeneCards)
Family 2
Subfamily F
Pseudogene No
CORP pseudogene probability score
Aliases OR7-1, OR7-6, WUGSC:H_DJ0669B10.1, HsOR7.6.6, ORL3179
External Ids HGNC: 8247   GeneBank: BK004214, NM_001004685   ORDB: ORL3179   
Build #39 labels OR2F2
Chromosomal location 7:143,935,233-143,936,183 (+)
Cluster 7@144
Synteny CLIC#16
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2F1 90.22% 317

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2F1C 84% 317
Dog OR2F1D 84% 317
Dog OR2F1 84% 317
Mouse Or2f2 85% 315
Mouse Or2f1 84% 317
Mouse Or2f1b 83% 317
Rat Or2f2 86% 315
Cow OR2F2B 87% 317
Cow OR2F1 86% 316
Orang OR2F2P 94% 317
Horse OR2F1 85% 317
Horse OR2F1F 83% 317
Horse OR2F1H 82% 317
Horse OR2F1G 84% 285
Chimp OR2F1 91% 317

Expression evidences

Source Accession
mRNA BC136813
GNF Atlas2 217302_at

Sequence information

Nucleotide sequence ATGGAAATAGATAACCAGACGTGGGTGAGAGAATTTATTCTCCTTGGCTTATCCAGTGAC
TGGTGCACTCAGATATCCCTGTTTTCCCTGTTCTTGGTCACATACCTCATGACAGTGCTG
GGGAACTGTCTCATTGTCCTTCTGATCAGACTGGACAGCCGACTCCACACTCCCATGTAT
TTCTTTCTCACCAACCTCTCCCTTGTCGATGTCTCCTATGCCACAAGCGTAGTCCCCCAG
CTGCTGGCACATTTTCTTGCAGAACATAAAGCCATCCCATTCCAGAGCTGTGCAGCCCAG
TTATTTTTCTCCCTGGCCTTGGGTGGGATTGAGTTTGTTCTCCTGGCAGTGATGGCCTAT
GACCGCCATGTGGCTGTGTCTGACCGCCTGCGATACTCGGCCATCATGCATGGAGGGCTG
TGTGCTAGGTTGGCCATCACATCCTGGGTCAGTGGCTCCATCAACTCTCTTGTGCAGACT
GCTATCACCTTTCAGCTGCCCATGTGCACTAACAAGTTTATTGATCACATATCCTGTGAA
CTCCTAGCTGTGGTCAGGCTGGCTTGTGTGGACACCTCCTCCAATGAGGCTGCCATCATG
GTGTCTAGCATTGTTCTTCTGATGACACCTTTCTGCCTGGTTCTGTTGTCCTACATCCGG
ATCATCTCCACCATCCTAAAGATCCAGTCCAGAGAAGGAAGAAAGAAAGCCTTCCACACG
TGTGCCTCTCACCTCACGGTGGTTGCCCTGTGCTACGGCACAACGATTTTCACTTACATC
CAGCCCCACTCTGGTCCCTCAGTCCTTCAAGAGAAGCTGATCTCTGTCTTCTATGCCATT
GTTATGCCTCTGCTGAACCCTGTGATTTATAGTCTAAGGAATAAAGAGGTGAAGGGGGCC
TGGCATAAACTATTAGAGAAATTCTCTGGGTTAACATCCAAGCTGGGAACT
Conceptual translation MEIDNQTWVREFILLGLSSDWCTQISLFSLFLVTYLMTVLGNCLIVLLIRLDSRLHTPMY
FFLTNLSLVDVSYATSVVPQLLAHFLAEHKAIPFQSCAAQLFFSLALGGIEFVLLAVMAY
DRHVAVSDRLRYSAIMHGGLCARLAITSWVSGSINSLVQTAITFQLPMCTNKFIDHISCE
LLAVVRLACVDTSSNEAAIMVSSIVLLMTPFCLVLLSYIRIISTILKIQSREGRKKAFHT
CASHLTVVALCYGTTIFTYIQPHSGPSVLQEKLISVFYAIVMPLLNPVIYSLRNKEVKGA
WHKLLEKFSGLTSKLGT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
7 100 -100 NS A/G T/A 1000GP (YRI, YRI, YRI, YRI)
7 100 -100 SYN G/T L/L 1000GP (YRI)
7 143,632,359 143,632,359 NS A/T I/F rs60344499 (DbSNP)
7 143,632,577 143,632,576 Ins(1) -/T rs34820838 (DbSNP)
7 143,632,618 143,632,618 NS C/T A/V rs2240359 (DbSNP)
7 143,632,717 143,632,717 NS A/G Q/R rs61739648 (DbSNP)
7 143,632,833 143,632,833 NS A/G T/A rs13229174 (DbSNP)
7 143,632,983 143,632,983 NS C/T R/W rs61746066 (DbSNP)
7 143,632,984 143,632,984 NS A/G Q/R rs61740239 (DbSNP)
7 143,633,013 143,633,013 NS G/T A/S rs4286866 (DbSNP)
7 143,633,157 143,633,157 NS C/T H/Y rs13235235 (DbSNP)
7 143,935,740 143,935,740 NS A/G T/A 1000GP (CEU)
7 143,935,890 143,935,890 NS C/T R/W 1000GP (CHBJPT)
7 143,935,891 143,935,891 NS G/A R/Q 1000GP (CEU)
7 143,936,064 143,936,064 NS T/C Y/H 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
7 143,147,775 144,368,638 CopyNumber Variation_3708 (DGV)
7 143,208,034 143,736,035 CopyNumber Variation_5247 (DGV)
7 143,217,296 144,074,520 CopyNumber Variation_32962 (DGV)
7 143,438,261 143,655,784 CopyNumber Variation_0725 (DGV), Variation_2109 (DGV)
7 143,545,719 143,874,190 CopyNumber Variation_53583 (DGV)
7 143,572,286 143,866,532 CopyNumber Variation_8581 (DGV)
7 143,615,165 143,744,519 CopyNumber Variation_0110 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R131Q T170A R220W R220Q Y278H % Freq CORP
1 R T R R Y 80.18 0.507
2 R A R R H 10.52 0.507
3 R T R R H 6.07 0.507
4 R T R Q Y 2.46 0.507
5 Q T R R Y 0.23 0.507
6 R T W R Y 0.23 0.507
7 R T W R H 0.23 0.507
8 Q T R Q Y 0.08 0.507

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2F2.aApr07-unspliced main_exon CDS chr7 143,935,233 143,936,183 +
3UTR chr7 143,936,183 143,936,186 +