Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2G3 Olfactory Receptor

Gene Symbol OR2G31 (View this gene in GeneCards)
Family 2
Subfamily G
Pseudogene No
CORP pseudogene probability score 0.2 (functional)
Aliases OR1-33, HsOR1.5.5, ORL3043
External Ids HGNC: 15008   GeneBank: AB065622, BK004417, NM_001001914   ORDB: ORL3043   
Build #39 labels OR2G3
Chromosomal location 1:247,605,586-247,606,512 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2B8P 63.46% 301
OR2G2 62.95% 305
OR2W6P 63.12% 301

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2G3 83% 309
Chimp CONTIG*********** 96% 309
Mouse Or2c1 62% 306
Rat Or2w6 64% 304
Cow OR2G3 89% 309

Expression evidences

Source Accession
mRNA BC136712
GNF Atlas2 gnf1h10914_at

Sequence information

Nucleotide sequence ATGGGATTGGGCAATGAGAGTTCCCTAATGGATTTCATCCTTCTAGGCTTCTCAGACCAC
CCTCGTCTGGAGGCTGTTCTCTTTGTATTTGTCCTTTTCTTCTACCTCCTGACCCTTGTG
GGAAACTTCACCATAATCATCATCTCATATCTGGATCCCCCTCTTCATACCCCAATGTAC
TTTTTTCTCAGCAACCTCTCTTTACTGGACATCTGCTTCACTACTAGCCTTGCTCCTCAG
ACCTTAGTTAACTTGCAAAGACCAAAGAAGACGATCACTTACGGTGGTTGTGTGGCGCAA
CTCTATATTTCTCTGGCACTGGGCTCCACTGAATGTATCCTCTTGGCTGACATGGCCTTG
GATCGGTACATTGCTGTCTGCAAACCCCTCCACTATGTAGTCATCATGAACCCACGGCTT
TGCCAACAGCTGGCATCTATCTCCTGGCTCAGTGGTTTGGCTAGTTCCCTAATCCATGCA
ACTTTTACCTTGCAATTGCCTCTCTGTGGCAACCATAGGCTGGACCATTTTATTTGCGAA
GTACCAGCTCTTCTCAAGTTGGCTTGTGTGGACACCACTGTCAATGAATTGGTGCTTTTT
GTTGTTAGTGTTCTGTTTGTTGTCATTCCACCAGCACTCATCTCCATCTCCTATGGCTTC
ATAACTCAAGCTGTGCTGAGGATCAAATCAGTAGAGGCAAGGCACAAAGCCTTCAGCACC
TGCTCCTCCCACCTTACAGTGGTGATTATATTCTATGGCACCATAATCTACGTGTACCTG
CAACCTAGTGACAGCTATGCCCAGGACCAAGGGAAGTTTATCTCCCTCTTCTACACCATG
GTGACCCCCACTTTAAATCCTATCATCTATACTTTAAGGAACAAGGATATGAAAGAGGCT
CTGAGGAAACTTCTCTCGGGAAAATTG
Conceptual translation MGLGNESSLMDFILLGFSDHPRLEAVLFVFVLFFYLLTLVGNFTIIIISYLDPPLHTPMY
FFLSNLSLLDICFTTSLAPQTLVNLQRPKKTITYGGCVAQLYISLALGSTECILLADMAL
DRYIAVCKPLHYVVIMNPRLCQQLASISWLSGLASSLIHATFTLQLPLCGNHRLDHFICE
VPALLKLACVDTTVNELVLFVVSVLFVVIPPALISISYGFITQAVLRIKSVEARHKAFST
CSSHLTVVIIFYGTIIYVYLQPSDSYAQDQGKFISLFYTMVTPTLNPIIYTLRNKDMKEA
LRKLLSGKL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS C/T P/S 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN C/T H/H 1000GP (YRI)
1 247,605,760 247,605,760 NS A/G M/V 1000GP (CEU)
1 247,605,915 247,605,915 SYN T/G T/T 1000GP (CEU)
1 247,606,290 247,606,290 SYN C/T H/H 1000GP (CEU, CHBJPT)
1 247,606,450 247,606,450 NS A/G I/V 1000GP (CEU, CHBJPT)
1 247,768,948 247,768,948 NS C/T P/S rs61751929 (DbSNP)
1 247,769,062 247,769,062 NS A/G M/V rs61748963 (DbSNP)
1 247,769,217 247,769,217 SYN G/T T/T rs61750030 (DbSNP)
1 247,769,378 247,769,378 NS C/T S/L rs6658792 (DbSNP)
1 247,769,419 247,769,419 NS A/G I/V rs61740146 (DbSNP)
1 247,769,425 247,769,425 NS A/G K/E rs56795889 (DbSNP)
1 247,769,430 247,769,430 SYN A/T V/V rs61740141 (DbSNP)
1 247,769,573 247,769,573 NS A/T K/I rs61744523 (DbSNP)
1 247,769,592 247,769,592 SYN C/T H/H rs1151683 (DbSNP)
1 247,769,659 247,769,659 NS A/G M/V rs12072304 (DbSNP)
1 247,769,752 247,769,752 NS A/G I/V rs61730407 (DbSNP)
1 247,769,786 247,769,786 NS A/C D/A rs61737569 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

P21S S49* M59V N65K L164S E180K K229I V258M I289V N294I A300D % Freq CORP
1 P S M N L E K V I N A 53.76 0.281
2 P S M N L E K V V N A 31.87 0.281
3 P S V N L E K V V N A 5.30 0.765
4 S S M N L E K M I N A 2.53 0.281
5 P S M N L E K M I N A 2.30 0.281
6 P S M N L K K V I N A 1.46 0.281
7 P S M N L E K V I N D 1.46 0.281
8 P S M N L K I V I N A 0.61 0.281
9 P S M K L E K V I N A 0.31 0.281
10 S S M N S E K M I N A 0.15 0.281
11 P S M N L K K V I I A 0.08 0.281
12 P S M N L E K V I I A 0.08 0.281
13 P * M N L E K V I N D 0.08 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2G3.aApr07-unspliced main_exon CDS chr1 247,605,586 247,606,512 +
3UTR chr1 247,606,512 247,606,515 +