Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2G6 Olfactory Receptor

Gene Symbol OR2G61 (View this gene in GeneCards)
Family 2
Subfamily G
Pseudogene No
CORP pseudogene probability score
Aliases
External Ids HGNC: 27019   
Build #39 labels
Chromosomal location 1:248,521,647-248,522,594 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2G3 65.35% 303
OR2G2 64.95% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2G6 87% 306
Mouse Or2y1d 62% 301
Rat Or2w6 62% 305
Cow OR2G6 88% 309

Expression evidences

Source Accession
mRNA BC137266

Sequence information

Nucleotide sequence |Strand=+|Length=ATGGAGGAAACCAACAACAGCTCTGAAAAGGGATTTCTTCTCC
TGGGATTTTCAGATCAGCCTCAGCTAGAGAGGTTTCTTTTTGCCATCATTTTGTACTTCT
ACGTCTTGAGCCTTCTGGGGAACACTGCCCTCATACTAGTATGTTGTCTGGACTCCAGAC
TCCACACTCCAATGTACTTCTTCCTCAGCAACCTCTCGTGTGTGGACATCTGCTTTACCA
CCAGTGTTGCCCCACAGTTGCTGGTTACCATGAATAAGAAAGACAAAACCATGAGCTACG
GTGGCTGTGTGGCCCAGCTCTATGTGGCCATGGGGTTGGGCTCGTCTGAGTGTATTCTCT
TGGCCGTCATGGCTTATGACCGCTATGCTGCTGTCTGCCGGCCACTGCGCTACATAGCCA
TTATGCACCCCAGGTTCTGTGCGTCTCTGGCCGGTGGAGCATGGCTCAGCGGCCTCATCA
CCTCCCTAATTCAGTGCTCCCTCACTGTGCAGCTGCCCCTCTGTGGTCATCGCACACTGG
ATCATATTTTCTGTGAGGTGCCAGTGCTCATCAAACTGGCCTGTGTGGATACGACTTTCA
ACGAGGCAGAACTCTTTGTGGCCAGTGTAGTCTTTCTAATTGTCCCGGTGTTACTCATCT
TAGTCTCCTATGGCTTTATCACTCAAGCTGTGTTAAGGATAAAATCAGCTGCGGGCCGCC
AAAAGGCCTTTGGGACCTGTTCGTCTCACCTGGTTGTGGTCATCATTTTCTATGGGACCA
TCATATTCATGTACCTTCAACCGGCCAATAGGAGATCCAAAAACCAGGGAAAGTTTGTTT
CTCTTTTCTATACCATAGTCACCCCACTTTTAAACCCCATTATCTACACTCTGAGAAACA
AAGATGTGAAAGGGGCCTTGAGGACCCTGATACTGGGTAGTGCTGCTGGACAAAGCCACA
AGGAC
Conceptual translation |Strand=+|Length=MEETNNSSEKGFLLLGFSDQPQLERFLFAIILYFYVLSLLGNT
ALILVCCLDSRLHTPMYFFLSNLSCVDICFTTSVAPQLLVTMNKKDKTMSYGGCVAQLYV
AMGLGSSECILLAVMAYDRYAAVCRPLRYIAIMHPRFCASLAGGAWLSGLITSLIQCSLT
VQLPLCGHRTLDHIFCEVPVLIKLACVDTTFNEAELFVASVVFLIVPVLLILVSYGFITQ
AVLRIKSAAGRQKAFGTCSSHLVVVIIFYGTIIFMYLQPANRRSKNQGKFVSLFYTIVTP
LLNPIIYTLRNKDVKGALRTLILGSAAGQSHKD

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS A/G M/V 1000GP (YRI, YRI, YRI, YRI)
1 100 -100 SYN T/C Y/Y 1000GP (YRI, YRI, YRI)
1 248,521,952 248,521,952 SYN T/C Y/Y 1000GP (CEU, CHBJPT)
1 248,522,418 248,522,418 NS A/T M/L 1000GP (CEU, CHBJPT)
1 248,685,122 248,685,122 NS A/G M/V rs58955396 (DbSNP)
1 248,685,253 248,685,253 SYN C/T Y/Y rs9727474 (DbSNP)
1 248,685,719 248,685,719 NS A/T M/L rs9330305 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,500,109 248,865,374 CopyNumber Variation_3340 (DGV)
1 248,522,680 249,158,239 CopyNumber Variation_8355 (DGV)
1 248,595,681 248,817,382 CopyNumber Variation_2359 (DGV)
1 248,626,918 248,830,541 Inversion Variation_37092 (DGV)
1 248,644,944 248,790,408 CopyNumber Variation_0263 (DGV)
1 248,646,428 248,728,407 Inversion Variation_59670 (DGV)
1 248,684,848 248,687,895 CopyNumber #34 (Waszak)
1 248,684,948 248,685,898 InDel Variation_41247 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V48I G152S I158M Y218D V248I M258L % Freq CORP
1 V G I Y V M 82.80 0.765
2 V G I Y V L 15.44 0.765
3 V G M Y V M 1.08 0.765
4 V S I Y I M 0.31 0.765
5 I G I Y V M 0.23 0.740
6 V G I D V M 0.15 0.765

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2G6.aApr07-unspliced main_exon CDS chr1 248,521,647 248,522,594 +
3UTR chr1 248,522,594 248,522,597 +