Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2H1 Olfactory Receptor

Gene Symbol OR2H11 (View this gene in GeneCards)
Family 2
Subfamily H
Pseudogene No
CORP pseudogene probability score 0.13 (functional)
Aliases OLFR42A-9004-14, dJ994E9.4, OR6-2, hs6M1-16, OR6-32, OLFR42A, HsOR6.3.23, ORL675
External Ids HGNC: 8252   GeneBank: AF042073, AF042074, AF042078, AF044491-AF044493, BK004209, HSA302604-HSA302613, HSA459845-HSA459847   ORDB: ORL675   
Build #39 labels OR2H1
Chromosomal location 6:29,461,770-29,462,717 (+)
Cluster 6@29
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2H2 86.86% 312
OR2H5P 83.01% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2H9P 72% 311
Mouse Or2h1 85% 312
Mouse Or2h2 84% 306
Rat Or2h1 85% 312
Rat Or2h2c 85% 312
Rat Or2h1b-ps 83% 313
Rat Or2h2 84% 308
Cow OR2H1D 83% 312
Orang OR2H1P 95% 316
Horse OR2H1F 86% 317
Horse OR2H1E 86% 312
Chimp OR2H2P 74% 359

Expression evidences

Source Accession
ESTs EL734021
mRNA HQ447990
GNF Atlas2 216817_s_at

Sequence information

Nucleotide sequence ATGGTTAACCAAAGCTCCCCCATGGGCTTCCTCCTTCTGGGCTTCTCTGAACACCCAGCA
CTGGAAAGGACTCTCTTTGTGGTTGTCTTCACTTCCTACCTCTTGACCCTGGTGGGCAAC
ACACTCATCATCCTGCTGTCTGTACTGTACCCCAGGCTCCACTCTCCAATGTACTTTTTC
CTCTCTGACCTCTCCTTCTTGGACCTCTGCTTTACCACAAGTTGTGTCCCCCAGATGCTG
GTCAACCTCTGGGGCCCAAAGAAGACCATCAGCTTCCTGGGATGCTCTGTCCAGCTCTTC
ATCTTCCTGTCCCTGGGGACCACTGAGTGCATCCTCCTGACAGTGATGGCCTTTGACCGA
TACGTGGCTGTCTGCCAGCCCCTCCACTATGCCACCATCATCCACCCCCGCCTGTGCTGG
CAGCTGGCATCTGTGGCCTGGGTTATGAGTCTGGTTCAATCGATAGTCCAGACACCATCC
ACCCTCCACTTGCCCTTCTGTCCCCACCAGCAGATAGATGACTTTTTATGTGAGGTCCCA
TCTCTGATTCGACTCTCCTGTGGAGATACCTCCTACAATGAAATCCAGTTGGCTGTGTCC
AGTGTCATCTTCGTGGTTGTGCCTCTCAGCCTCATCCTTGCCTCTTATGGAGCCACTGCC
CAGGCAGTGCTGAGGATTAACTCTGCCACAGCATGGAGAAAGGCCTTTGGGACCTGCTCC
TCCCATCTCACTGTGGTCACCCTCTTCTACAGCTCAGTCATTGCTGTCTACCTCCAGCCC
AAAAATCCGTATGCCCAAGGGAGGGGCAAGTTCTTTGGTCTCTTCTATGCAGTGGGCACT
CCTTCACTTAACCCTCTCGTATACACCCTGAGGAACAAGGAGATAAAGCGAGCACTCAGG
AGGTTACTAGGGAAGGAAAGAGACTCCAGGGAAAGCTGGAGAGCTGCT
Conceptual translation MVNQSSPMGFLLLGFSEHPALERTLFVVVFTSYLLTLVGNTLIILLSVLYPRLHSPMYFF
LSDLSFLDLCFTTSCVPQMLVNLWGPKKTISFLGCSVQLFIFLSLGTTECILLTVMAFDR
YVAVCQPLHYATIIHPRLCWQLASVAWVMSLVQSIVQTPSTLHLPFCPHQQIDDFLCEVP
SLIRLSCGDTSYNEIQLAVSSVIFVVVPLSLILASYGATAQAVLRINSATAWRKAFGTCS
SHLTVVTLFYSSVIAVYLQPKNPYAQGRGKFFGLFYAVGTPSLNPLVYTLRNKEIKRALR
RLLGKERDSRESWRAA

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 NS G/A M/I 1000GP (YRI, YRI)
6 100 -100 SYN C/T S/S 1000GP (YRI, YRI, YRI, YRI)
6 29,429,549 29,429,549 NS G/T M/I rs62408592 (DbSNP)
6 29,429,551 29,429,551 NS G/T G/V rs61750048 (DbSNP)
6 29,429,642 29,429,642 SYN C/T S/S rs61752584 (DbSNP)
6 29,429,732 29,429,732 SYN C/T S/S rs61732184 (DbSNP)
6 29,429,733 29,429,733 NS A/G N/D rs61732185 (DbSNP)
6 29,429,765 29,429,765 SYN A/G T/T rs41271553 (DbSNP)
6 29,430,170 29,430,170 SYN T/C P/P rs2073148 (DbSNP)
6 29,430,213 29,430,213 NS A/G M/V rs17184086 (DbSNP)
6 29,430,344 29,430,344 NS A/T Q/H rs17177681 (DbSNP)
6 29,461,988 29,461,988 SYN A/G T/T 1000GP (CEU)
6 29,462,393 29,462,393 SYN T/C P/P 1000GP (CEU, CHBJPT)
6 29,462,436 29,462,436 NS G/A V/M 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 33 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M57I D63N L80P V223M Q266H K270N P281R % Freq CORP
1 M D L V Q K P 91.94 0.299
2 M N L V Q K P 3.99 0.299
3 M D L V H K P 1.46 0.299
4 I D L V Q K P 0.77 0.780
5 M D L M Q K P 0.61 0.589
6 M D P V Q K P 0.61 0.243
7 M D L V Q K R 0.38 0.444
8 M D L V Q N P 0.23 0.299

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2H1.aApr07 exon_5UTR chr6 29,458,453 29,458,569 +
exon_5UTR chr6 29,460,404 29,460,454 +
main_exon 5UTR chr6 29,461,499 29,461,770 +
CDS chr6 29,461,770 29,462,717 +
3UTR chr6 29,462,717 29,464,205 +
OR2H1.bApr07 exon_5UTR chr6 29,457,180 29,457,207 +
exon_5UTR chr6 29,458,454 29,458,569 +
exon_5UTR chr6 29,460,404 29,460,454 +
main_exon 5UTR chr6 29,461,499 29,461,770 +
CDS chr6 29,461,770 29,462,717 +
3UTR chr6 29,462,717 29,462,733 +
OR2H1.cApr07 exon_5UTR chr6 29,459,772 29,460,184 +
main_exon 5UTR chr6 29,461,475 29,461,770 +
CDS chr6 29,461,770 29,462,717 +
3UTR chr6 29,462,717 29,462,733 +
exon_3UTR chr6 29,463,749 29,464,328 +
OR2H1.dApr07 exon_5UTR chr6 29,458,354 29,458,569 +
exon_5UTR chr6 29,460,404 29,460,454 +
main_exon 5UTR chr6 29,461,495 29,461,770 +
CDS chr6 29,461,770 29,462,717 +
3UTR chr6 29,462,717 29,464,320 +
OR2H1.eApr07 exon_5UTR chr6 29,457,160 29,457,207 +
exon_5UTR chr6 29,458,454 29,458,569 +
exon_5UTR chr6 29,459,275 29,459,369 +
exon_5UTR chr6 29,460,404 29,460,454 +
exon_5UTR chr6 29,461,495 29,461,750 +
main_exon CDS_partial chr6 29,461,991 29,462,717 +
3UTR chr6 29,462,717 29,462,720 +
OR2H1.fApr07 exon_5UTR chr6 29,458,559 29,458,569 +
exon_5UTR chr6 29,460,404 29,460,454 +
exon_5UTR chr6 29,461,495 29,461,750 +
main_exon CDS_partial chr6 29,462,004 29,462,717 +
3UTR chr6 29,462,717 29,462,720 +
OR2H1.gApr07 exon_5UTR chr6 29,456,977 29,457,207 +
exon_5UTR chr6 29,458,454 29,458,569 +
main_exon 5UTR chr6 29,461,495 29,461,770 +
CDS_partial chr6 29,461,770 29,461,900 +
OR2H1.hApr07 exon_5UTR chr6 29,457,160 29,457,207 +
exon_5UTR chr6 29,458,454 29,458,569 +
exon_5UTR chr6 29,460,404 29,460,454 +
main_exon 5UTR chr6 29,461,495 29,461,770 +
CDS_partial chr6 29,461,770 29,461,965 +