Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2H5P Olfactory Receptor

Gene Symbol OR2H5P1 (View this gene in GeneCards)
Family 2
Subfamily H
Pseudogene Yes
CORP pseudogene probability score
Aliases OR6-35, hs6M1-13, HS271M21, OST616, OLFR24B, OR6-33, OLFR42B, HsOR6.3.25P, ORL3155
External Ids HGNC: 8256   GeneBank: AB065470, AF042075, AF042076, BK004545, BK004662, NG_002319   ORDB: ORL3155   
Build #39 labels OR2H5P
Chromosomal location 6:29,573,897-29,574,833 (+)
Cluster 6@29
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2H2 88.78% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2H9P 70% 309
Mouse Or2h2 83% 307
Rat Or2h2 83% 307
Cow OR2H1D 79% 312
Orang OR2H2P 89% 312
Horse OR2H1 82% 306
Chimp OR2H2P 77% 359
Chimp OR2H1 80% 306

Sequence information

Nucleotide sequence GAGGAACAGGCCATGGTTAACCAAAGCTCCGCACCAGGCTTTCTCCTTCTGGGCTTCTCT
GAACACCCAGCACTGGAAAGGACTCTCTTTGTAGTTGTCTTCACTTCCTACCTCCTAACC
CCGGTGGACTCATCATCCTGCTGTCTGTGCTGGACCCCAGGCTCCACTCTCCAATGTACT
TTTTCCTCTCCAACCTCTCCTTCTTGGACCTCTGTTTCACCATAAGTTGTGTCCCCGGGA
TGCTGGTCAACCTCTGGGAGCCAAAGAAGACCATCATCTTACTGGGCTGCTCTGTCCAGT
TCTTCATCTTCCTGTCCCTGGGGACCACTGAGTGCATCCTCCTGACGGTGATGGCCTTTG
ACCGCTACATGGCTATCTTCAAGCCCCTGCGCCATGCCACCATCGTCCACCTCTGCCTGT
GCTGGCAGCTGGCATCTGTGGCCTGGGTCATTGGGCTGGTAGAGTCAGTGGTCCAGACAC
CATCCACCCTGCGCCTGCCTTTCTGCCCCCATCAGCAGGTGGATGATTTTGTCTGTGAGG
TCCCAGCTCTAATTCGACTCTCCTGTGAAGACACCTCCTACAATGAGATCCAGATGGCTG
TTGCCAGTGTCTTCATCTTGGCTGTGCCTCAGCCTCATCCTTGTCTCTTATGGAGCCATT
GCCTGGGCAGTGCTAAGGACTAACTGCAAAAGGGCAGAGGAAAGCTTTTGGGACCTGCTC
CTCCCATCTCACTGTGGTCACCCTCTTCTACAGCTCAGTCATTGCTGTCTACCTCCAGCC
CAAAAATCCCTATGCCCAAGAGAGGGGCAAGTTCTTTGGTCTCTTCTATGCAGTGGGCAC
TCCTTCACTTAACCCTCTCATATACACCCTGAGGAACAAGGAGGTAACCAGGGCATTCAG
GAGATTGCTGGCGAAGGAAATGGGGCTCATACAAAGT
Conceptual translation EEQAMVNQSSAPGFLLLGFSEHPALERTLFVVVFTSYLLT/GGLIILLSVLDPRLHSPM
YFFLSNLSFLDLCFTISCVPGMLVNLWEPKKTIILLGCSVQFFIFLSLGTTECILLTVMA
FDRYMAIFKPLRHATIVHLCLCWQLASVAWVIGLVESVVQTPSTLRLPFCPHQQVDDFVC
EVPALIRLSCEDTSYNEIQMAVASVFILAVP\LILVSYGAIAWAVLR\TAKGQRKAFG
TCSSHLTVVTLFYSSVIAVYLQPKNPYAQERGKFFGLFYAVGTPSLNPLIYTLRNKEVTR
AFRRLLAKEMGLIQS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 SNP G/A 1000GP (YRI)
6 29,542,064 29,542,064 SNP A/G rs72507815 (DbSNP)
6 29,542,220 29,542,220 SNP A/C rs28359959 (DbSNP)
6 29,542,445 29,542,445 SNP T/C rs1233398 (DbSNP)
6 29,542,543 29,542,543 SNP C/T rs13206667 (DbSNP)
6 29,542,544 29,542,544 SNP C/G rs13190969 (DbSNP)
6 29,542,601 29,542,601 SNP C/G rs13190791 (DbSNP)
6 29,542,604 29,542,604 SNP A/G rs13190685 (DbSNP)
6 29,574,287 29,574,287 SNP G/A 1000GP (CHBJPT)
6 29,574,518 29,574,518 SNP C/T 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
6 29,469,101 29,678,670 CopyNumber Variation_3598 (DGV)
6 29,527,407 29,566,446 CopyNumber Variation_36504 (DGV)
6 29,541,574 29,544,610 CopyNumber #41 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.