Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2J4P Olfactory Receptor

Gene Symbol OR2J4P1 (View this gene in GeneCards)
Family 2
Subfamily J
Pseudogene Yes
CORP pseudogene probability score
Aliases OR6-9, hs6M1-5, OR6-20, dJ80I19.5, HsOR6.3.9P, ORL3167
External Ids HGNC: 8262   GeneBank: AB065683, BK004756, NG_004684, XM_498072   ORDB: ORL3167   
Build #39 labels OR2J4P
Chromosomal location 6:29,181,510-29,182,442 (+)
Cluster 6@29
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2J3 89.71% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2B2 59% 303
Mouse Or2j3 77% 304
Rat Or2j3 78% 297
Cow OR2J3 85% 309
Cow OR2J3C 85% 304
Cow OR2J3D 85% 304
Cow OR2J3B 84% 304
Orang OR2J3 84% 318
Orang OR2J1 85% 306
Orang OR2J2 81% 304
Horse OR2J3 87% 305
Horse OR2J1 86% 306
Horse OR2J3G 85% 306
Chimp OR2J3 90% 311

Sequence information

Nucleotide sequence ATGAATGATGATGGAAAAGTCAATGCTAGCTCTGAGGGGTACTTTATTTTAGTTGGATTT
TCTAATTGGCCTTATCTGGAAGTAGTTCTCTTTGTGGTTATTTTGATCTTCTGCTTGATG
ACACTGATAGGAAACCTGTTCATCATCATCCTGACGTACCTGGACTCCCATCTCCATACT
CCCTTGTATTTCTTCCTTTCAAATCTCTCATTTCTGGATCTCTGCTACACCACCAGCTCT
ATCCCTCAGTTGCTGGTCAGTCTCTGGGGTGTGGAAAAGACCATTTCTTATGCTGGTTGC
ATGGTTCAACTTTACTTTTTTCTCACACTGGGAACCACAGAGTGTGTCCTACTGGTGGTG
ATGTCCTATGACCGTTATGCAGCTGTGTGTAGACCTTTGCATTACACTGTCCTCATGCAC
TCTCGTTTCTGCCACTTGTTGGCTGTGGCTTCTTGGGTAAGTGGTTTTACAAACCCAGCA
CTTCATTCCTCCTTCACCTTCTGGGTACCTCTGTGTGGACACCGCCAAATAGATCACTTT
TTCTGTGAAGTTCCGGCACTTTTATGATTATCATTTGTCAATACCCGTGAAAATAAACTG
ACCCTCATGATCACAAGCTCCATTTTTGTTCTGCTACTTCTCACCCTCATTTTCACTTCC
TATGGTGCTATTGCCCAGGCTGTACTGAGGATGCAGTCAACCACTGGGCTTCAGAAAGTA
TTTGGAACATGTGGAGCTCATCATATGGTTGTATCTCTCTTTTTCATTCCGGCCATGTGC
ATGTATCTCCAGCCACCATCAGGGAATTCTCAAGATCAAGGCAAGTTCATTGCTCTCTTT
TATACTGTTGTTACACCTAGTCTTAACCCTCTAATCTACACCCTCAGAAACAAAGATGTA
AGAGGGGTAGTGAAGAGACTAAGGGGGTGGGAG
Conceptual translation MNDDGKVNASSEGYFILVGFSNWPYLEVVLFVVILIFCLMTLIGNLFIIILTYLDSHLHT
PLYFFLSNLSFLDLCYTTSSIPQLLVSLWGVEKTISYAGCMVQLYFFLTLGTTECVLLVV
MSYDRYAAVCRPLHYTVLMHSRFCHLLAVASWVSGFTNPALHSSFTFWVPLCGHRQIDHF
FCEVPALLXSFVNTRENKLTLMITSSIFVLLLLTLIFTSYGAIAQAVLRMQSTTGLQKV
FGTCGAHHMVVSLFFIPAMCMYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKDV
RGVVKRLRGWE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 SNP A/G 1000GP (YRI, YRI, YRI)
6 29,149,442 29,149,442 SNP A/G rs3116816 (DbSNP)
6 29,149,511 29,149,511 SNP C/G rs9501302 (DbSNP)
6 29,149,561 29,149,561 SNP A/G rs3116817 (DbSNP)
6 29,149,605 29,149,605 SNP G/T rs3116818 (DbSNP)
6 29,149,606 29,149,606 SNP C/T rs9918458 (DbSNP)
6 29,149,632 29,149,632 SNP G/T rs3129168 (DbSNP)
6 29,149,645 29,149,645 SNP C/T rs3116819 (DbSNP)
6 29,150,080 29,150,079 Ins(1) -/G rs35274516 (DbSNP)
6 29,181,665 29,181,665 SNP A/G 1000GP (CEU, CHBJPT)
6 29,181,784 29,181,784 SNP G/A 1000GP (CEU, CHBJPT)
6 29,181,828 29,181,828 SNP G/T 1000GP (CEU, CHBJPT)
6 29,181,855 29,181,855 SNP T/G 1000GP (CEU, CHBJPT)
6 29,181,868 29,181,868 SNP C/T 1000GP (CEU, CHBJPT)
6 29,182,104 29,182,104 SNP A/G 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
6 29,091,539 29,163,849 CopyNumber Variation_64459 (DGV)
6 29,099,579 29,149,561 CopyNumber Variation_51868 (DGV)
6 29,149,187 29,152,219 Deletion, CopyNumber #280 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.