Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2L13 Olfactory Receptor

Gene Symbol OR2L131 (View this gene in GeneCards)
Family 2
Subfamily L
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases HsOR1.5.27
External Ids HGNC: 19578   GeneBank: BC028158, CR599101, NM_175911   
Build #39 labels OR2L13, OR2L14
Chromosomal location 1:248,099,376-248,100,311 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2L1P 72.61% 303
OR2L2 72.61% 303
OR2L3 72.28% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2L13 87% 312
Chimp CONTIG1126.6-6908 99% 312
Mouse Or2l13 84% 311
Mouse Or2l13b 84% 311
Rat Or2l13 84% 311
Rat Or2l13d 83% 311
Rat Or2l13c 83% 311
Cow OR2L13 87% 311

Expression evidences

Source Accession
ESTs DV080104
mRNA HQ447997

Sequence information

Nucleotide sequence ATGGAGAAATGGAATCACACTTCAAATGATTTCATTTTGTTGGGTCTGCTTCCCCCAAAT
CAAACTGGAATATTTCTCTTGTGCCTTATCATCCTCATATTCTTTCTGGCCTCGGTGGGT
AACTCGGCCATGATTCACCTCATCCACGTGGATCCTCGTCTCCACACACCGATGTACTTT
CTTCTCAGCCAGCTCTCCCTTATGGACCTGATGTACATCTCCACCACCGTCCCCAAGATG
GCGTACAACTTCCTGTCCGGCCAGAAAGGCATCTCCTTCCTGGGATGTGGTGTGCAAAGC
TTCTTCTTCCTGACCATGGCGTGTTCTGAAGGCTTACTCCTGACCTCCATGGCCTACGAC
CGTTATTTGGCCATCTGCCACTCTCTCTATTATCCTATCCGCATGAGTAAAATGATGTGT
GTGAAGATGATTGGAGGCTCTTGGACACTGGGGTCCATCAACTCCTTGGCACACACAGTC
TTTGCCCTTCATATTCCCTACTGCAGGTCTAGGGCTATTGACCATTTCTTCTGCGATGTC
CCAGCCATGTTGCTTCTTGCCTGTACAGATACTTGGGTCTATGAATATATGGTTTTTGTA
AGTACAAGCCTCTTTCTCCTTTTCCCTTTCATTGGCATCACTTCTTCCTGTGGCCGAGTC
CTATTTGCTGTCTATCATATGCACTCAAAGGAGGGGAGAAAAAAGGCCTTCACCACCATT
TCAACACATTTAACTGTAGTGATCTTTTACTATGCACCTTTTGTCTACACCTATCTTCGG
CCCAGGAATCTCCGCTCACCAGCTGAAGACAAGATCCTGGCAGTCTTCTACACCATCCTT
ACCCCCATGCTCAATCCCATTATCTACAGCCTGAGGAATAAGGAAGTCCTGGGGGCTATG
AGGAGAGTGTTTGGGATATTCTCTTTCCTGAAAGAA
Conceptual translation MEKWNHTSNDFILLGLLPPNQTGIFLLCLIILIFFLASVGNSAMIHLIHVDPRLHTPMYF
LLSQLSLMDLMYISTTVPKMAYNFLSGQKGISFLGCGVQSFFFLTMACSEGLLLTSMAYD
RYLAICHSLYYPIRMSKMMCVKMIGGSWTLGSINSLAHTVFALHIPYCRSRAIDHFFCDV
PAMLLLACTDTWVYEYMVFVSTSLFLLFPFIGITSSCGRVLFAVYHMHSKEGRKKAFTTI
STHLTVVIFYYAPFVYTYLRPRNLRSPAEDKILAVFYTILTPMLNPIIYSLRNKEVLGAM
RRVFGIFSFLKE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 248,263,471 248,263,471 NS A/G H/R rs45577033 (DbSNP)
1 248,262,984 248,262,984 NS C/T L/F rs12727564 (DbSNP)
1 248,263,495 248,263,495 NS G/T R/L rs74153072 (DbSNP)
1 248,263,145 248,263,145 NS G/T L/F rs12742561 (DbSNP)
1 248,262,941 248,262,941 SYN A/G Q/Q rs12738485 (DbSNP)
1 248,262,983 248,262,983 SYN C/T F/F rs12753704 (DbSNP)
1 248,100,169 248,100,169 NS G/A R/H 1000GP (CEU)
1 100 -100 NS C/T T/I 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 247,849,473 248,277,638 CopyNumber Variation_48302 (DGV)
1 247,849,473 248,285,441 CopyNumber Variation_48303 (DGV)
1 248,145,644 248,277,638 CopyNumber Variation_48304 (DGV)
1 248,179,503 248,290,781 CopyNumber Variation_74987 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V50L T257I R265H L273R M283V % Freq CORP
1 V T R L M 90.02 1.000
2 V T R R M 6.53 1.000
3 V I R L M 1.69 1.000
4 V T H L M 1.08 1.000
5 V T R L V 0.46 1.000
6 L T R L M 0.23 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2L13.aApr07 exon_5UTR chr1 247,937,191 247,937,384 +
exon_5UTR chr1 248,098,651 248,098,775 +
main_exon 5UTR chr1 248,099,358 248,099,376 +
CDS chr1 248,099,376 248,100,311 +
3UTR chr1 248,100,311 248,100,995 +
OR2L13.bApr07 exon_5UTR chr1 247,937,023 247,937,384 +
main_exon 5UTR chr1 248,099,358 248,099,376 +
CDS_partial chr1 248,099,376 248,099,972 +
exon_3UTR chr1 248,115,375 248,115,466 +