Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2L1P Olfactory Receptor

Gene Symbol OR2L1P1 (View this gene in GeneCards)
Family 2
Subfamily L
Pseudogene Yes
CORP pseudogene probability score
Aliases HSHTPCRX02, HsOR1.5.21P
External Ids HGNC: 8265   GeneBank: AB065442, AF546406-AF546419, HSHTPRX02, NR_002145   
Build #39 labels OR2L1, OR2L7P
Chromosomal location 1:247,990,267-247,991,191 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2L2 90.26% 308
OR2L3 87.62% 307
OR2L5 90.26% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2L3B 83% 306
Dog OR2L5C 81% 307
Dog OR2L5 82% 307
Chimp OR2L1 98% 308
Mouse Or2l5 80% 307
Rat Or2l5 80% 307
Rat Or2l5b 80% 307
Cow OR2L3 82% 307
Cow OR2L3C 81% 307
Cow OR2L2B 81% 306
Cow OR2L2C 80% 307
Orang OR2L1 95% 308
Horse OR2L5 85% 307
Horse OR2L5JP 83% 307
Horse OR2L5D 84% 307

Expression evidences

Source Accession
mRNA X64980

Sequence information

Nucleotide sequence ATGGAAAATTACAATCAAACATCAACTGCTTTCATCTTGTTGGGATTGTCGCCACCACCA
AAAATTGGCCATTTCATCTTCATTCTCATTAATTTCGTTTTCCTAATGGCTCTAATTGGA
AACCTATCCATGATTCTTCTCATCTTCTTGGACATCCATCTCCACACACCCATGTATTTC
CTACTTAGTCAGCTCTCCCTCATTGACCTAAATTATATTTCCACCATTGTTCCTAAGATG
GTTTATGATTTTTCTGTATGGAAACAAGTCTATCTCCTTCACTGGGTGTGGGATTCAGAG
TTTCTTCTTCCTGACTTTAGCAGGTGCAGAAGCGCTGCTCCTGACATCAATGGCCTATGA
TCGTTATGTGGCTATTTGCTTTCCTCTCCACTATCCCATCCGTATGAGAAAAAGAGTGTG
TGCACTGATGATAACAGGATCTTGGATGATAGGCTCCATCAACTCTTGTGCTCACACGGT
ATATGCACTCCGTATCCCATATTGCAAGTCCAGAGCCATCAATCATTTTTTCTGTGATGT
TCCAGCTATGTTGACCCTAGCCTGCACGGATACCTGGGTCTATGAGTGCACGGTGTTTTT
GAGCACCACCATTTTTCTTGTGTTTCCCTTCATTTGTATTGCATGTTCCTATGGCCGGAT
TCTCCTTGCTGTCTACCACATGCACTCTGCAGAAGGGAGGAAGAAGGCCTATTCGACCTG
CAGCACCCACCTCACTGTAGTGACTTTCTACTATGCACCCTTTGCTTATACCTATCTACG
CCCAAGATCCCTGCGATCTCCGACAGAGGACAAGGTTCTGGCTGTCTTCTACACCATCCT
CACTCCAATGCTCAACCCCATCATCTACAGCCTGAGAAACAAGGAGGTGATGGGGGCCCT
GACACGAGTGATTCAGAAAATCTTT
Conceptual translation MENYNQTSTAFILLGLSPPPKIGHFIFILINFVFLMALIGNLSMILLIFLDIHLHTPMYF
LLSQLSLIDLNYISTIVPKMVYDF\YGNKSISFTGCGIQSFFFLTLAGAEALLLTSMAY
DRYVAICFPLHYPIRMRKRVCALMITGSWMIGSINSCAHTVYALRIPYCKSRAINHFFCD
VPAMLTLACTDTWVYECTVFLSTTIFLVFPFICIACSYGRILLAVYHMHSAEGRKKAYST
CSTHLTVVTFYYAPFAYTYLRPRSLRSPTEDKVLAVFYTILTPMLNPIIYSLRNKEVMGA
LTRVIQKIF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 SNP T/A 1000GP (YRI, YRI, YRI, YRI)
1 247,990,276 247,990,276 SNP T/A 1000GP (CEU, CHBJPT)
1 247,990,311 247,990,311 SNP A/T 1000GP (CEU, CHBJPT)
1 247,990,922 247,990,922 SNP C/T 1000GP (CEU)
1 247,991,191 247,991,191 SNP / 1000GP (CHBJPT)
1 248,153,578 248,153,578 SNP A/T rs72475091 (DbSNP)
1 248,153,613 248,153,613 SNP A/T rs72475092 (DbSNP)
1 248,153,665 248,153,665 SNP A/G rs74155865 (DbSNP)
1 248,154,224 248,154,224 SNP C/T rs4925586 (DbSNP)
1 248,154,347 248,154,347 SNP C/T rs72763231 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 247,849,473 248,277,638 CopyNumber Variation_48302 (DGV)
1 247,849,473 248,285,441 CopyNumber Variation_48303 (DGV)
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,145,644 248,277,638 CopyNumber Variation_48304 (DGV)
1 248,153,469 248,156,493 Deletion #186 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2L1P.aApr07-unspliced main_exon CDS_partial chr1 247,990,639 247,990,981 +