Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2L2 Olfactory Receptor

Gene Symbol OR2L21 (View this gene in GeneCards)
Family 2
Subfamily L
Pseudogene No
CORP pseudogene probability score 0.01 (functional)
Aliases OR1-48, HSHTPCRH07, HsOR1.5.24, ORL36
External Ids HGNC: 8266   GeneBank: AB065597, BK004752, HSHTPRH07, NM_001004686   ORDB: ORL36   
Build #39 labels OR2L4P, OR2L2, OR2L12
Chromosomal location 1:248,038,268-248,039,203 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2L1P 90.26% 308
OR2L5 90.06% 312
OR2L8 85.58% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2L5 82% 312
Dog OR2L3B 80% 312
Dog OR2L3 80% 312
Chimp CONTIG658.7-1602 98% 312
Mouse Or2l5 80% 307
Rat Or2l5b 79% 307
Cow OR2L3 83% 312
Cow OR2L3C 80% 312
Cow OR2L2C 81% 312
Cow OR2L2B 80% 312
Cow OR2L2 83% 253

Expression evidences

Source Accession
mRNA X64978

Sequence information

Nucleotide sequence ATGGAAAATTACAATCAAACATCAACTGATTTCATCTTATTGGGGCTGTTCCCACAATCA
AGAATTGGCCTTTTCGTATTCACCCTCATTTTTCTCATTTTCCTAATGGCTCTAATTGGA
AATCTATCCATGATTCTTCTCATCTTTTTGGACATCCATCTCCACACACCTATGTATTTC
CTACTTAGTCAGCTCTCCCTCATTGACCTAAATTACATCTCCACCATTGTTCCAAAGATG
GTTTATGATTTTCTGTATGGAAACAAGTCTATCTCCTTCACTGGATGTGGGATTCAGAGT
TTCTTCTTCTTGACTTTAGCAGTTGCAGAAGGGCTGCTCCTGACATCAATGGCCTATGAT
CGTTATGTGGCCATTTGCTTTCCTCTCCACTATCCCATCCGTATAAGCAAAAGAGTGTGT
GTGATGATGATAACAGGATCTTGGATGATAAGCTCTATCAACTCTTGTGCTCACACAGTA
TATGCACTCTGTATCCCATATTGCAAGTCCAGAGCCATCAATCATTTTTTCTGTGATGTT
CCAGCTATGTTGACGCTAGCCTGCACAGACACTTGGGTCTATGAGAGCACAGTGTTTTTG
AGCAGCACCATCTTTCTTGTGCTTCCTTTCACTGGTATTGCATGTTCCTATGGCCGGGTT
CTCCTTGCTGTCTACCGCATGCACTCTGCAGAAGGGAGGAAGAAGGCCTATTCAACCTGT
AGCACCCACCTCACTGTAGTGTCCTTCTACTATGCACCCTTTGCTTATACCTATGTACGT
CCAAGATCCCTGCGATCTCCAACAGAGGACAAGATTCTGGCTGTTTTCTACACCATCCTC
ACCCCAATGCTCAACCCCATCATCTACAGCCTGAGAAACAAGGAGGTGATGGGGGCCCTG
ACACAAGTGATTCAGAAAATCTTCTCAGTGAAAATG
Conceptual translation MENYNQTSTDFILLGLFPQSRIGLFVFTLIFLIFLMALIGNLSMILLIFLDIHLHTPMYF
LLSQLSLIDLNYISTIVPKMVYDFLYGNKSISFTGCGIQSFFFLTLAVAEGLLLTSMAYD
RYVAICFPLHYPIRISKRVCVMMITGSWMISSINSCAHTVYALCIPYCKSRAINHFFCDV
PAMLTLACTDTWVYESTVFLSSTIFLVLPFTGIACSYGRVLLAVYRMHSAEGRKKAYSTC
STHLTVVSFYYAPFAYTYVRPRSLRSPTEDKILAVFYTILTPMLNPIIYSLRNKEVMGAL
TQVIQKIFSVKM

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 248,202,316 248,202,316 NS C/G F/L rs12134979 (DbSNP)
1 248,202,344 248,202,344 NS C/G L/V rs6658141 (DbSNP)
1 248,201,892 248,201,892 NS G/T G/V rs73141397 (DbSNP)
1 248,202,382 248,202,382 SYN A/G K/K rs6658161 (DbSNP)
1 248,202,283 248,202,283 SYN A/G S/S rs73141398 (DbSNP)
1 248,202,211 248,202,211 SYN A/G A/A rs56102617 (DbSNP)
1 248,202,340 248,202,340 SYN C/G T/T rs12134981 (DbSNP)
1 248,202,289 248,202,289 SYN C/T C/C rs72763251 (DbSNP)
1 248,201,879 248,201,879 SYN C/T L/L rs73141396 (DbSNP)
1 248,038,909 248,038,909 SYN A/G A/A 1000GP (CEU)
1 248,039,042 248,039,042 NS G/C V/L 1000GP (CEU, CHBJPT)
1 248,038,927 248,038,927 SYN T/C V/V 1000GP (CHBJPT)
1 248,038,931 248,038,931 NS C/T L/F 1000GP (CHBJPT)
1 248,038,993 248,038,993 SYN C/A T/T 1000GP (CHBJPT)
1 100 -100 SYN A/T P/P 1000GP (YRI, YRI, YRI, YRI)
1 100 -100 NS T/G V/G 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 247,849,473 248,277,638 CopyNumber Variation_48302 (DGV)
1 247,849,473 248,285,441 CopyNumber Variation_48303 (DGV)
1 248,145,644 248,277,638 CopyNumber Variation_48304 (DGV)
1 248,179,503 248,290,781 CopyNumber Variation_74987 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

C96Y V108G R121H S202T Y250C V259L % Freq CORP
1 C V R S Y V 62.83 0.027
2 C V R S Y L 31.18 0.027
3 C G R S Y L 2.61 0.027
4 C V H S Y L 1.23 0.327
5 C V R T Y L 1.15 0.027
6 C V R S C L 0.46 0.036
7 Y V R T Y L 0.46 0.691
8 Y V R S Y L 0.08 0.691

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2L2.aApr07-unspliced main_exon 5UTR chr1 248,038,172 248,038,268 +
CDS chr1 248,038,268 248,039,203 +
3UTR chr1 248,039,203 248,039,305 +