Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2L3 Olfactory Receptor

Gene Symbol OR2L31 (View this gene in GeneCards)
Family 2
Subfamily L
Pseudogene No
CORP pseudogene probability score
Aliases HsOR1.5.25, ORL3039
External Ids HGNC: 15009   GeneBank: AB065950, NM_001004687   ORDB: ORL3039   
Build #39 labels OR2L3
Chromosomal location 1:248,060,682-248,061,617 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2L6P 92.63% 312
OR2L8 95.51% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2L5 81% 312
Dog OR2L5C 81% 312
Dog OR2L3B 82% 312
Dog OR2L3 82% 312
Chimp CONTIG658.2-1937 97% 312
Chimp CONTIG*********** 95% 312
Mouse Or2l5 79% 312
Rat Or2l5b 79% 312
Cow OR2L3 84% 312
Cow OR2L3C 81% 312
Cow OR2L2C 80% 312
Cow OR2L2 80% 255

Expression evidences

Source Accession
ESTs EG357668
mRNA BC137040

Sequence information

Nucleotide sequence ATGGAAAATTACAATCAAACATCAACTGATTTCATCTTATTAGGATTCTTCCCACCATCA
AGAATTGGCCTTTTCCTCTTCATCCTCATTGTTTTCATTTTCCTAATGGCTCTAATTGGA
AACCTATCCATGATTCTTCTCATCTTCTTGGACACCCATCTCCACACACCCATGTATTTC
CTACTTAGTCAGCTCTCCCTCATTGACCTAAATTACATCTCCACCATTGTTCCTAAGATG
GCATCTGATTTTCTGTCTGGTAACAAGTCTATCTCCTTCACTGGGTGTGGGATTCAGAGT
TTCTTCTTCTCGGCATTAGGAGGTGCAGAAGCACTACTTTTGGCATCTATGGCCTATGAT
CGTTACATTGCTATTTGCTTTCCTCTTCACTATCCCATCCGCATGAGCAAAAGAATGTGT
GTGCTGATGATAACAGGGTCTTGGATCATAGGCTCGATCAATGCTTGTGCTCACACTGTA
TATGTACTCCATATTCCTTATTGCCAATCCAGGGCCATCAATCATTTCTTCTGTGATGTC
CCAGCAATGGTGACTCTGGCCTGCATGGACACCTGGGTCTATGAGGGCACAGTGTTTTTG
AGCACCACCATCTTTCTCGTGTTTCCCTTCATTGCTATTTCATGTTCCTATGGCCGGGTT
CTCCTTGCTGTCTACCACATGAAATCTGCAGAAGGGAGGAAGAAAGCCTACCTGACCTGC
AGCACCCACCTCACTGTAGTAACTTTCTACTATGCACCTTTTGTCTACACTTATCTACGT
CCAAGATCCCTGCGATCTCCAACAGAGGACAAGGTTCTGGCTGTCTTCTACACCACCCTC
ACTCCAATGCTCAACCCCATCATCTATAGCCTGAGGAACAAGGAGGTGATGGGGGCCCTG
ACACGAGTGAGTCAGAGAATCTGCTCTGGGAAAATG
Conceptual translation MENYNQTSTDFILLGFFPPSRIGLFLFILIVFIFLMALIGNLSMILLIFLDTHLHTPMYF
LLSQLSLIDLNYISTIVPKMASDFLSGNKSISFTGCGIQSFFFSALGGAEALLLASMAYD
RYIAICFPLHYPIRMSKRMCVLMITGSWIIGSINACAHTVYVLHIPYCQSRAINHFFCDV
PAMVTLACMDTWVYEGTVFLSTTIFLVFPFIAISCSYGRVLLAVYHMKSAEGRKKAYLTC
STHLTVVTFYYAPFVYTYLRPRSLRSPTEDKVLAVFYTTLTPMLNPIIYSLRNKEVMGAL
TRVSQRICSGKM

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 248,224,587 248,224,587 NS A/G T/A rs61525219 (DbSNP)
1 248,224,398 248,224,398 NS A/G M/V rs55937620 (DbSNP)
1 248,224,489 248,224,489 NS A/G Q/R rs56834114 (DbSNP)
1 248,224,578 248,224,578 NS C/T L/F rs60743763 (DbSNP)
1 248,224,294 248,224,294 NS C/T S/L rs6658256 (DbSNP)
1 248,224,099 248,224,099 NS C/T T/I rs6666048 (DbSNP)
1 248,224,216 248,224,216 NS C/T P/L rs6658227 (DbSNP)
1 248,224,746 248,224,746 NS G/T V/F rs6697812 (DbSNP)
1 248,224,586 248,224,586 SYN C/T S/S rs60429598 (DbSNP)
1 248,224,754 248,224,754 SYN C/T T/T rs55893924 (DbSNP)
1 248,060,992 248,060,992 NS C/T S/L 1000GP (CEU)
1 248,061,187 248,061,187 NS A/G Q/R 1000GP (CEU)
1 248,061,096 248,061,096 NS A/G M/V 1000GP (CEU, CHBJPT)
1 100 -100 NS A/G M/V 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 247,849,473 248,277,638 CopyNumber Variation_48302 (DGV)
1 247,849,473 248,285,441 CopyNumber Variation_48303 (DGV)
1 248,145,644 248,277,638 CopyNumber Variation_48304 (DGV)
1 248,179,503 248,290,781 CopyNumber Variation_74987 (DGV)
1 248,223,884 248,226,919 CopyNumber #29 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

P78L S82P S104L M139V A212G A236V % Freq CORP
1 P S S M A A 54.53 0.030
2 L S L V A A 16.44 0.076
3 P S S M G A 9.45 0.030
4 P S L M A A 9.14 0.030
5 P S L M G A 3.46 0.030
6 L S L V G A 2.38 0.076
7 L S L M A A 0.84 0.076
8 L S S V A A 0.77 0.076
9 P S S M A V 0.77 0.080
10 L S S M A A 0.54 0.076
11 L S S V G A 0.46 0.076
12 P S S V A A 0.23 0.030
13 L P L V A A 0.15 0.076
14 P S S M G V 0.15 0.080
15 L S L M G A 0.15 0.076
16 P S S V G A 0.15 0.030
17 L P S V A A 0.08 0.076
18 L S S M G A 0.08 0.076
19 P S L V G A 0.08 0.030
20 L P L M A A 0.08 0.076
21 L P S M A A 0.08 0.076

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2L3.aApr07-unspliced main_exon CDS chr1 248,060,682 248,061,617 +
3UTR chr1 248,061,617 248,061,620 +