Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2L5 Olfactory Receptor

Gene Symbol OR2L51 (View this gene in GeneCards)
Family 2
Subfamily L
Pseudogene No
CORP pseudogene probability score 0.01 (functional)
Aliases OR1-53, HsOR1.5.23
External Ids HGNC: 15011   GeneBank: AB065956, AF399485, BK004458, NG_004275   
Build #39 labels OR2L5, OR2L11, OR2L5P
Chromosomal location 1:248,021,948-248,022,883 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2L1P 90.26% 308
OR2L2 90.06% 312
OR2L8 87.5% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2L5 84% 312
Dog OR2L5C 82% 312
Dog OR2L3B 82% 312
Dog OR2L3 82% 312
Chimp CONTIG*********** 97% 311
Mouse Or2l5 80% 312
Rat Or2l5b 81% 307
Rat Or2l5 81% 307
Cow OR2L3 84% 312
Cow OR2L3C 81% 312
Cow OR2L2 83% 253

Sequence information

Nucleotide sequence ATGGAAAATTACAATCAAACGTCAACTGATTTCATCTTATTGGGGCTGTTCCCACCATCA
AAAATTGGCCTTTTCCTCTTCATTCTCTTTGTTCTCATTTTCCTAATGGCTCTAATTGGA
AACCTATCCATGATTCTTCTCATCTTCTTGGACACCCATCTCCACACACCCATGTATTTC
CTGCTTAGTCAGCTCTCCCTCATTGACCTAAATTACATCTCTACGATTGTTCCTAAGATG
GCTTCTGATTTTCTGTATGGAAACAAGTCTATCTCCTTCATTGGGTGTGGGATTCAGAGT
TTCTTCTTCATGACTTTTGCAGGTGCAGAAGCGCTGCTCCTGACATCAATGGCCTATGAT
CGTTATGTGGCCATTTGCTTTCCTCTCCACTATCCCATCCGTATGAGCAAAAGAATGTAT
GTGCTGATGATAACAGGATCTTGGATGATAGGCTCCATCAACTCTTGTGCTCACACAGTA
TATGCATTCCGTATCCCATATTGCAAGTCCAGAGCCATCAATCATTTTTTCTGTGATGTT
CCAGCTATGTTGACATTAGCCTGTACAGACACCTGGGTCTATGAGTACACAGTGTTTTTG
AGCAGCACCATCTTTCTTGTGTTTCCCTTCACTGGCATTGCGTGTTCCTATGGCTGGGTT
CTCCTTGCTGTCTACCGCATGCACTCTGCAGAAGGGAGGAAAAAGGCCTATTCGACCTGC
AGCACCCACCTCACTGTAGTAACTTTCTACTATGCACCCTTTGCTTATACCTATCTATGT
CCAAGATCCCTGCGATCTCTGACAGAGGACAAGGTTCTGGCTGTTTTCTACACCATCCTC
ACCCCAATGCTCAACCCCATCATCTACAGCCTGAGAAACAAGGAGGTGATGGGGGCCCTG
ACACGAGTGATTCAGAATATCTTCTCGGTGAAAATG
Conceptual translation MENYNQTSTDFILLGLFPPSKIGLFLFILFVLIFLMALIGNLSMILLIFLDTHLHTPMYF
LLSQLSLIDLNYISTIVPKMASDFLYGNKSISFIGCGIQSFFFMTFAGAEALLLTSMAYD
RYVAICFPLHYPIRMSKRMYVLMITGSWMIGSINSCAHTVYAFRIPYCKSRAINHFFCDV
PAMLTLACTDTWVYEYTVFLSSTIFLVFPFTGIACSYGWVLLAVYRMHSAEGRKKAYSTC
STHLTVVTFYYAPFAYTYLCPRSLRSLTEDKVLAVFYTILTPMLNPIIYSLRNKEVMGAL
TRVIQNIFSVKM

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 248,186,104 248,186,103 Ins(1) -/C rs35816537 (DbSNP)
1 248,185,883 248,185,883 NS A/G S/G rs55982561 (DbSNP)
1 248,185,951 248,185,951 SYN A/G K/K rs12753585 (DbSNP)
1 248,185,339 248,185,339 SYN C/T F/F rs61748759 (DbSNP)
1 248,022,581 248,022,581 NS G/A G/S 1000GP (CEU)
1 248,022,698 248,022,698 NS T/C Y/H 1000GP (CHBJPT)
1 100 -100 SYN T/C F/F 1000GP (YRI, YRI)
1 100 -100 NS G/A R/H 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 247,849,473 248,277,638 CopyNumber Variation_48302 (DGV)
1 247,849,473 248,285,441 CopyNumber Variation_48303 (DGV)
1 248,145,644 248,277,638 CopyNumber Variation_48304 (DGV)
1 248,179,503 248,290,781 CopyNumber Variation_74987 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S152F R164H P166S V198L G212S G218D R226C Y251H % Freq CORP
1 S R P V G G R Y 95.31 0.019
2 S R P V S G R Y 1.69 0.019
3 S R P V G G R H 0.92 0.005
4 S R S V G D R Y 0.77 0.019
5 S H P V G G R Y 0.31 0.019
6 S R P V G G C Y 0.31 0.019
7 S R P V G D R Y 0.31 0.019
8 S R P L G G R Y 0.23 0.019
9 F R P V G G R Y 0.08 0.019
10 S H P V G D R Y 0.08 0.019