Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2M1P Olfactory Receptor

Gene Symbol OR2M1P1 (View this gene in GeneCards)
Family 2
Subfamily M
Pseudogene Yes
CORP pseudogene probability score
Aliases OST037, JCG10, HsOR1.5.28P
External Ids HGNC: 8267   GeneBank: AF308814, AF399615, NR_002141   
Build #39 labels OR2M1
Chromosomal location 1:248,121,932-248,122,861 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2M2 89.68% 310
OR2M5 90.61% 309
OR2M7 90% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2M10P 77% 308
Chimp CONTIG1126.8-1510 93% 310
Chimp CONTIG25656.1-1150 91% 310
Chimp CONTIG1126.11-12304 89% 308
Mouse Or2m12 70% 308
Rat Or2m12 71% 307
Cow OR2M10 74% 310

Expression evidences

Source Accession
mRNA AF308814

Sequence information

Nucleotide sequence ATGGCATGGGAGAATCAGACCTTCAACTCCGGCTTCATCCTCCTGGGAATCTTCAATCAC
AGCCCCACCCGCACCTTCCTCTTCTTTCTGGTCCTGTGCATCTTTTAGGTGGCCTTCATG
GGAAACTCCCTCATGGTTCTCCTAATCTACCTGGATACCCAGCTCCATACCCCCATGTAC
TTCCTCCTCAGTCAACTGTCCCCCATGGACGTCAGGCTCATCTGCACCACCGTACCCAAG
ATGGCCTTCAACTACTTGTCTGGCAGCAAGTCCATTTCTATGGCTGGCTGTGCCACACAA
ATTTTCTTCTGTGTATCACTGCTTGGCTCTGAATGCTTTCTGTTGGCTGTTATGTCTTAT
GACTGCTACATTGCCATTTGCCACCCTCTAAGATACACCAATCTCATGAGACCCAAAATT
TGTAGACTTATGACTGCCTTCTCCTGGATCCTGGGCTCTACAGATGGAATCATTTATGCT
GTAGCCACATTTTCCTTCTCCTACTGTGGGTCTCGGGAAATAGCCCACTTCTTCTGTGAG
TTACCTTCCCTACTAATCCTCTCATGCAATGACACATCAATATTTGAAAAGGTTATTTTC
ATTTGCTCTATAGTAATGCTTGTTTTCCCTGTTGCAATCATCATTGCTTCCTATGCTGGA
GTTATTCTGGCTGTCATTCACATGGGATCTGGAGAGGGTCGTCGCAAAGCTTTCACGACC
TGTTCCTCTCACCTCATGGTGGTGGGAATGTTCTATGGAGCAGGTTTGTTCATGTACATA
CAGCCCACATCTGATCGCTCCCCAACGCAGGACAAGCTGGTGTCTGTATTCTACACCATC
CTCACTCCCATGCTGAATCCCCTCATCTACAGCCTCCGCAACAAGGAAGTGACCAGAGCA
TTCATGAAGATCTCAGGAAAGGGCAAGTCT
Conceptual translation MAWENQTFNSGFILLGIFNHSPTRTFLFFLVLCIFXAFMGNSLMVLLIYLDTQLHTPMY
FLLSQLSPMDVRLICTTVPKMAFNYLSGSKSISMAGCATQIFFCVSLLGSECFLLAVMSY
DCYIAICHPLRYTNLMRPKICRLMTAFSWILGSTDGIIYAVATFSFSYCGSREIAHFFCE
LPSLLILSCNDTSIFEKVIFICSIVMLVFPVAIIIASYAGVILAVIHMGSGEGRRKAFTT
CSSHLMVVGMFYGAGLFMYIQPTSDRSPTQDKLVSVFYTILTPMLNPLIYSLRNKEVTRA
FMKISGKGKS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 248,285,413 248,285,413 SNP A/C rs41308200 (DbSNP)
1 248,285,906 248,285,906 SNP A/G rs41295946 (DbSNP)
1 248,285,487 248,285,487 SNP A/G rs6587423 (DbSNP)
1 248,285,436 248,285,436 SNP C/T rs74153080 (DbSNP)
1 248,286,039 248,286,039 SNP C/T rs73141235 (DbSNP)
1 248,285,311 248,285,311 SNP C/T rs41308202 (DbSNP)
1 248,286,088 248,286,088 SNP G/A rs72478206 (DbSNP)
1 248,285,441 248,285,441 SNP G/T rs6587422 (DbSNP)
1 248,122,009 248,122,009 SNP C/T 1000GP (CEU, CHBJPT)
1 248,122,139 248,122,139 SNP G/T 1000GP (CEU, CHBJPT)
1 248,122,534 248,122,534 SNP T/G 1000GP (CEU, CHBJPT)
1 100 -100 SNP G/T 1000GP (YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 247,849,473 248,285,441 CopyNumber Variation_48303 (DGV)
1 248,179,503 248,290,781 CopyNumber Variation_74987 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2M1P.aApr07-unspliced main_exon CDS_partial chr1 248,122,283 248,122,800 +