Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2M4 Olfactory Receptor

Gene Symbol OR2M41 (View this gene in GeneCards)
Family 2
Subfamily M
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases OR1-55, HSHTPCRX18, OST710, HsOR1.5.32, ORL203
External Ids HGNC: 8270   GeneBank: AB065953, AF399617, BK004483, HSHTPRX18, HSTPCR100, NM_017504   ORDB: ORL203   
Build #39 labels OR2M4
Chromosomal location 1:248,238,929-248,239,861 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2M2 74.11% 309
OR2M3 74.43% 309
OR2M5 74.43% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2M10P 77% 307
Chimp CONTIG1126.25-643 99% 311
Mouse Or2m12 70% 307
Rat Or2m12 70% 308
Cow OR2M4 83% 310

Expression evidences

Source Accession
mRNA AB463960
GNF Atlas2 gnf1h05779_at

Sequence information

Nucleotide sequence ATGGTGTGGGAAAACCAGACCTTCAACTCCATCTTCATCCTGCTGGGAATCTTCAATCAC
AGTCCCACCCACACCTTCCTTTTTTCTCTGGTCCTGGGCATCTTCTCACTGGCATTGATG
GAAAATATTTCCATGGTTCTCCTCATCTACATAGAGAAACAGCTCCACACCCCCATGTAC
TTCCTCCTCAGTCAACTGTCCCTTATGGACCTCATGCTCATCTGCACCACTCTACCCAAG
ATGATCTTCAGCTACTTGTCTGGGAAGAAATCTATCTCTCTGGCAGGTTGTGGAACTCAG
ATATTCTTCTATGTGTCCCTGCTTGGAGCTGAATGTTTCTTGTTGGCTGTCATGGCTTAT
GACCGCTATGTGGCTATATGTCACCCTCTTCAGTACACCATCCTCATGAATCCGAAACTC
TGTGTCTTCATGACTGTTGCTTCCTGGACCTTGGGGTCTCTTGATGGGATCATAGTGCTT
GCAGCTGTCCTGTCATTTTCTTACTGCAGCTCTCTGGAAATTCATCACTTTTTCTGTGAT
GTTGCTGCCCTTTTACCTCTATCCTGCACAGAAACATCTGCATTTGAAAGACTACTTGTC
ATTTGTTGTGTGGTAATGCTAATCTTTCCAGTTTCAGTTATCATACTTTCCTATTCCCAT
GTCCTTCGAGCCGTCATCCACATGGGCTCTGGGGAAAGTCGTCGCAAGGCCTTCACTACC
TGCTCCTCCCACCTGTCTGTGGTCGGACTCTACTACGGTGCTGCTATGTTCATGTACATG
AGACCAGCTTCTAAACATACGCCAGACCAGGACAAGATGGTGTCGGCCTTCTACACTATT
CTCACCCCTATGCTGAACCCTCTCATTTATAGCCTCCGCAACAAAGAAGTGTTCAGGGCA
CTACAGAAGGTACTGAAGAAAAGAAAGTTAATA
Conceptual translation MVWENQTFNSIFILLGIFNHSPTHTFLFSLVLGIFSLALMENISMVLLIYIEKQLHTPMY
FLLSQLSLMDLMLICTTLPKMIFSYLSGKKSISLAGCGTQIFFYVSLLGAECFLLAVMAY
DRYVAICHPLQYTILMNPKLCVFMTVASWTLGSLDGIIVLAAVLSFSYCSSLEIHHFFCD
VAALLPLSCTETSAFERLLVICCVVMLIFPVSVIILSYSHVLRAVIHMGSGESRRKAFTT
CSSHLSVVGLYYGAAMFMYMRPASKHTPDQDKMVSAFYTILTPMLNPLIYSLRNKEVFRA
LQKVLKKRKLI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 SYN C/T H/H 1000GP (YRI)
1 248,239,080 248,239,080 NS T/A I/K 1000GP (CEU)
1 248,239,456 248,239,456 SYN C/T H/H 1000GP (CEU, CHBJPT)
1 248,402,594 248,402,594 NS C/T R/C rs61743231 (DbSNP)
1 248,402,758 248,402,758 SYN C/T H/H rs6666148 (DbSNP)
1 248,402,989 248,402,989 SYN G/T G/G rs11586547 (DbSNP)
1 248,403,015 248,403,015 NS A/C Q/P rs41303133 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 62 (Hasin)
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,319,780 248,490,372 CopyNumber Variation_31702 (DGV)
1 248,402,131 248,405,163 CopyNumber #31 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I51K P262Q S275L % Freq CORP
1 I P S 99.02 0.110
2 I Q S 0.55 0.110
3 K P S 0.22 0.110
4 I P L 0.22 0.110

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2M4.aApr07-unspliced main_exon CDS chr1 248,238,929 248,239,861 +
3UTR chr1 248,239,861 248,239,864 +