Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2N1P Olfactory Receptor

Gene Symbol OR2N1P1 (View this gene in GeneCards)
Family 2
Subfamily N
Pseudogene Yes
CORP pseudogene probability score
Aliases OR6-18, dJ80I19.3, OR6-7, hs6M1-2, OR6-17, HsOR6.3.7P, ORL3166
External Ids HGNC: 8271   GeneBank: AF399498, BK004435, BK004664, HSA302624-HSA302633, NG_002216   ORDB: ORL3166   
Build #39 labels OR2N1P
Chromosomal location 6:29,137,883-29,138,816 (-)
Cluster 6@29
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2B11 57.48% 301
OR2B2 55.41% 305
OR2B6 57.37% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2B2 59% 312
Mouse Or2n1 83% 312
Mouse Or2n1d 82% 312
Mouse Or2n1b 82% 309
Rat Or2n1h 82% 312
Rat Or2n1 82% 312
Rat Or2n1g 82% 308
Rat Or2n1j 81% 312
Cow OR2N1 85% 312
Cow OR2N1O 85% 312
Orang OR2N1 94% 312
Horse OR2N1Q 86% 312
Horse OR2N1 86% 312
Horse OR2N1R 85% 312
Chimp OR2N1 97% 312

Expression evidences

Source Accession
GNF Atlas2 221382_at

Sequence information

Nucleotide sequence ATGCCACTAACTAATGAAAGCCACCCTGAAGAATTTATTCTGCTAGGCTTTGCAGACCGC
CCTTGGCTAGAGCTTCCTCTGTTCACTAGTCTTCTTATAATGTACCCTATAGCCGTGATG
GGAAACATCACAATCATTCTCATGTCCAGGTTAGACTCTCGTCTTCATAGCCCCATGTAT
TTCTTCCTCACCAACCTCTCCTTTTTGGACATGTGTTATACCACAAGCATTGTCCCTCAG
ATGCTGTTTAACCTGGGAAGCTCTAAGAAGACCATCAGCTATATGGGGTGTGCGGTTCAG
CTTTATTTCTTTCACATAATGGGGGGAACAGAATGTTTGCTTTTGGCTATTATGTCCTTT
GATCGCTATGTGGCCATCTGCAGACCTCTTCACTACACCCTCATCATGAATCAGCGCGTC
TGTATCCTTAGTTTCCACCGTGTGGCTAATTGGAATAATCTATGCTGTCTCAGAGGCCAC
TGCCACATTACAATTGCCACTGTGTGGTCTCAATAAACTGGACCACTTGGTGTGTGAGAT
TCCTGTTCTGATAAAGATTGCCTGTGGTGAAAAGGGTTCTAACGAGCTCACACTCTCTGT
GGTATGCATTTTTATGTTAGCTGTCCCACTATGCTTAATTCTTGCTTCCTATGCTAGTAT
TGGAAGTGCTGTATTTAAGATCAAATCTTCCAAGGGAAGGAAAAAGGCCTTTGGGACATG
CTCCTCCCATCTTATTGTAGTTTTCTTATTTTATGGCCCAGCCATCAGCATGTACCTTCA
GCCCCCCTCCTCCATCTCAAGGGATCAACCCAAGTTCATGGCCCTCTTCTATGGAGTGGT
GACTCCCTCACTCAACCCTTTTATCTACACCCTGCGGAATAAGAATGTAAAGGGGGCATT
ACGCAACTTGGTGAGGAGCATTTTCAGCTTTAAG
Conceptual translation MPLTNESHPEEFILLGFADRPWLELPLFTSLLIMYPIAVMGNITIILMSRLDSRLHSPMY
FFLTNLSFLDMCYTTSIVPQMLFNLGSSKKTISYMGCAVQLYFFHIMGGTECLLLAIMSF
DRYVAICRPLHYTLIMNQRVCI/XPP/WLIGIIYAVSEATATLQLPLCGLNKLDHLV
CEIPVLIKIACGEKGSNELTLSVVCIFMLAVPLCLILASYASIGSAVFKIKSSKGRKKAF
GTCSSHLIVVFLFYGPAISMYLQPPSSISRDQPKFMALFYGVVTPSLNPFIYTLRNKNVK
GALRNLVRSIFSFK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 SNP C/T 1000GP (YRI, YRI, YRI)
6 29,105,796 29,105,796 SNP C/G rs7775256 (DbSNP)
6 29,105,940 29,105,940 SNP G/T rs58523512 (DbSNP)
6 29,106,226 29,106,226 SNP G/T rs9257512 (DbSNP)
6 29,106,348 29,106,348 SNP C/T rs11760154 (DbSNP)
6 29,106,468 29,106,468 SNP A/G rs2267632 (DbSNP)
6 29,138,168 29,138,168 SNP G/A 1000GP (CEU)
6 29,138,422 29,138,422 SNP T/C 1000GP (CEU)
6 29,138,691 29,138,691 SNP G/A 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
6 29,091,539 29,163,849 CopyNumber Variation_64459 (DGV)
6 29,099,579 29,149,561 CopyNumber Variation_51868 (DGV)
6 29,103,660 29,106,693 Deletion #267 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.