Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2T11 Olfactory Receptor

Gene Symbol OR2T111 (View this gene in GeneCards)
Family 2
Subfamily T
Pseudogene No
CORP pseudogene probability score
Aliases OR1-65, HsOR1.5.47
External Ids HGNC: 19574   GeneBank: AB065614, BK004476, NM_001001964   
Build #39 labels OR2T11
Chromosomal location 1:248,626,181-248,627,128 (-)
Cluster 1@248
Synteny CLIC#5
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs1892443)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2T1 66.13% 310
OR2T2 71.01% 307
OR2T35 71.01% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2T11 90% 312
Chimp CONTIG6443.3-1119 97% 316
Mouse Or2t35 70% 307
Rat Or2t35 72% 306
Cow OR2T11 90% 306

Expression evidences

Source Accession
mRNA BC140749
GNF Atlas2 gnf1h10951_at

Sequence information

Nucleotide sequence ATGACGAACACATCATCCTCTGACTTCACCCTCCTGGGGCTTCTGGTGAACAGTGAGGCT
GCCGGGATTGTATTTACAGTGATCCTTGCTGTTTTCTTGGGGGCCGTGACTGCAAATTTG
GTCATGATATTCTTGATTCAGGTGGACTCTCGCCTCCACACCCCCATGTACTTTCTGCTC
AGTCAGCTGTCCATCATGGACACCCTTTTCATCTGTACCACTGTCCCAAAACTCCTGGCA
GACATGGTTTCTAAAGAGAAGATCATTTCCTTTGTGGCCTGTGGCATCCAGATCTTCCTC
TACCTGACCATGATTGGTTCTGAGTTCTTCCTCCTGGGCCTCATGGCCTATGACTGCTAC
GTGGCTGTCTGTAACCCTCTGAGATACCCAGTCCTGATGAACCGCAAGAAGTGTCTTTTG
CTGGCTGCTGGTGCCTGGTTTGGGGGCTCCCTCGATGGCTTTCTGCTCACTCCCATCACC
ATGAATGTCCCTTACTGTGGCTCCCGAAGTATCAACCATTTTTTCTGTGAGATCCCAGCA
GTTCTGAAACTGGCCTGTGCAGACACGTCCTTGTATGAAACTCTGATGTACATCTGCTGT
GTCCTCATGTTGCTCATCCCCATCTCTATCATCTCCACTTCCTACTCCCTCATCTTGTTA
ACCATCCACCGCATGCCCTCTGCTGAAGGTCGCAAAAAGGCCTTCACCACTTGTTCCTCC
CACTTGACTGTAGTTAGCATCTTCTATGGGGCTGCCTTCTACACATACGTGCTGCCCCAG
TCCTTCCACACCCCCGAGCAGGACAAAGTAGTGTCAGCCTTCTATACCATTGTCACGCCC
ATGCTTAATCCTCTCATCTACAGCCTCAGAAACAAGGACGTCATAGGGGCATTTAAAAAG
GTATTTGCATGTTGCTCATCTGCTCAGAAAGTAGCAACAAGTGATGCT
Conceptual translation MTNTSSSDFTLLGLLVNSEAAGIVFTVILAVFLGAVTANLVMIFLIQVDSRLHTPMYFLL
SQLSIMDTLFICTTVPKLLADMVSKEKIISFVACGIQIFLYLTMIGSEFFLLGLMAYDCY
VAVCNPLRYPVLMNRKKCLLLAAGAWFGGSLDGFLLTPITMNVPYCGSRSINHFFCEIPA
VLKLACADTSLYETLMYICCVLMLLIPISIISTSYSLILLTIHRMPSAEGRKKAFTTCSS
HLTVVSIFYGAAFYTYVLPQSFHTPEQDKVVSAFYTIVTPMLNPLIYSLRNKDVIGAFKK
VFACCSSAQKVATSDA

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS T/C Q/R 1000GP (YRI, YRI)
1 248,626,203 248,626,203 NS T/C Q/R 1000GP (CEU, CHBJPT)
1 248,626,440 248,626,440 NS C/A G/V 1000GP (CHBJPT)
1 248,626,452 248,626,452 NS G/C P/R 1000GP (CEU, CHBJPT)
1 248,626,521 248,626,521 NS A/C M/R 1000GP (CEU)
1 248,626,774 248,626,774 NS A/G C/R 1000GP (CEU, CHBJPT)
1 248,626,866 248,626,866 NS A/G I/T 1000GP (CEU, CHBJPT)
1 248,626,898 248,626,898 SYN T/C K/K 1000GP (CEU, CHBJPT)
1 248,789,504 248,789,504 NS C/T R/Q rs1892442 (DbSNP)
1 248,789,753 248,789,753 NS C/G R/P rs28555577 (DbSNP)
1 248,790,075 248,790,075 NS A/G C/R rs1892443 (DbSNP)
1 248,790,167 248,790,167 NS A/G I/T rs34397542 (DbSNP)
1 248,790,199 248,790,199 SYN C/T K/K rs34674180 (DbSNP)
1 248,790,269 248,790,269 NS G/A T/I rs61733992 (DbSNP)
1 248,790,425 248,790,425 NS A/G M/T rs41308178 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber, Deletion 157 (Hasin)
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,500,109 248,865,374 CopyNumber Variation_3340 (DGV)
1 248,522,680 249,158,239 CopyNumber Variation_8355 (DGV)
1 248,595,681 248,817,382 CopyNumber Variation_2359 (DGV)
1 248,626,918 248,830,541 Inversion Variation_37092 (DGV)
1 248,644,944 248,790,408 CopyNumber Variation_0263 (DGV)
1 248,687,510 248,865,377 CopyNumber Variation_0017 (DGV)
1 248,701,948 248,877,423 CopyNumber Variation_2056 (DGV)
1 248,703,193 248,795,305 CopyNumber Variation_75000 (DGV)
1 248,727,899 248,808,428 CopyNumber Variation_38963 (DGV)
1 248,727,928 248,796,682 CopyNumber Variation_6818 (DGV)
1 248,729,106 248,795,518 CopyNumber Variation_66541 (DGV)
1 248,732,055 248,795,305 CopyNumber Variation_74999 (DGV)
1 248,738,015 248,795,518 CopyNumber Variation_66540 (DGV)
1 248,738,074 248,795,564 CopyNumber Variation_31705 (DGV)
1 248,749,194 248,797,213 CopyNumber Variation_38068 (DGV)
1 248,749,930 248,795,305 CopyNumber Variation_74998 (DGV)
1 248,751,305 248,795,305 CopyNumber Variation_84995 (DGV)
1 248,784,859 248,793,623 CopyNumber Variation_1025 (DGV)
1 248,787,482 248,790,529 Deletion, CopyNumber #18 (Waszak)
1 248,789,479 248,790,429 CopyNumber Variation_41248 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Q309R T279M P226R M203R C119R I88T P55R T54N V24A T2M % Freq CORP
1 R T P M R I P T V T 76.27 0.118
2 R T R M R T P T V T 10.14 0.118
3 Q T P M C I P T V T 7.14 0.703
4 R T P M C I P T V T 4.76 0.703
5 R T P R R I P T V T 0.46 0.118
6 R T R M R T P N V T 0.23 0.118
7 R T P M R I P T A T 0.23 0.118
8 R T P M R T P T V T 0.23 0.118
9 R T R M R T P T V M 0.08 0.118
10 R T R M C I P T A T 0.08 0.703
11 R M P M R I P T V T 0.08 0.118
12 R T P M R I P T V M 0.08 0.118
13 R T R M C T P T V T 0.08 0.703
14 Q T P M R I P T V T 0.08 0.118
15 R T P M R I R T V T 0.08 0.221

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2T11.aApr07-unspliced main_exon 3UTR chr1 248,626,178 248,626,181 -
CDS chr1 248,626,181 248,627,128 -