Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2T12 Olfactory Receptor

Gene Symbol OR2T121 (View this gene in GeneCards)
Family 2
Subfamily T
Pseudogene No
CORP pseudogene probability score 0.12 (functional)
Aliases OR1-57, HsOR1.5.34
External Ids HGNC: 19592   GeneBank: AB065960, BK004485, NM_001004692   
Build #39 labels OR2T12
Chromosomal location 1:248,294,619-248,295,578 (-)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2T32P 96.25% 320
OR2T33 95.31% 320

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2T15 77% 312
Chimp CONTIG1126.4-2200 97% 320
Chimp CONTIG*********** 94% 320
Mouse Or2t44 73% 316
Rat Or2t44 71% 314
Cow OR2T13 75% 312

Sequence information

Nucleotide sequence ATGGAGATGAGAAATACTACCCCAGATTTTATTCTCCTAGGACTCTTTAACCACACCAGA
GCCCACCAAGTCCTCTTCATGATGCTTCTGGCCACCGTTTTGACCTCCCTGTTTAGCAAT
GCCCTCATGATTCTCCTGATTCACTGGGACCACCGGCTCCACAGGCCCATGTACTTCCTC
CTGAGCCAACTTTCCCTCATGGACATGATGCTGGTTTCCACCACTGTGCCCAAAATGGCG
GCTGACTACTTGACCGGAAATAAGGCCATCTCCCGCGCTGGCTGTGGTGTGCAGATCTTC
TTCCTCCCCACACTGGGTGGTGGAGAGTGCTTCCTCTTAGCAGCCATGGCCTATGACCGC
TATGCGGCTGTCTGCCACCCACTCCGATATCCCACTCTCATGAGCTGGCAGCTGTGCCTG
AGGATGACCATGTCGTCCTGGCTCCTGGGTGCAGCTGACGGCCTCCTGCAGGCTGTTGCT
ACCCTGAGCTTCCCATATTGCGGTGCACACGAGATCGATCACTTCTTCTGCGAGGCCCCC
GTGTTGGTGCGTTTGGCTTGTGCTGACACTTCAGTCTTCGAAAACGCCATGTACATCTGC
TGTGTGTTAATGCTCCTGGTCCCCTTTTCCCTCATCCTGTCCTCCTATGGTCTCATCCTC
GCTGCTGTTCTGCTCATGCGCTCTACAGAAGCCCGCAAGAAGGCCTTTGCCACCTGCTCT
TCACATGTGGCTGTGGTGGGACTCTTTTATGGAGCTGGCATTTTTACCTATATGAGACCC
AAATCCCACAGGTCCACTAACCACGATAAGGTTGTGTCAGCCTTCTATACTATGTTCACC
CCTTTACTAAATCCCCTCATCTACAGTGTGAGGAACAGTGAGGTCAAGGAAGCCCTGAAA
CGGTGGCTGGGGACGTGTGTAAACCTAAAACACCAGCAAAATGAGGCCCACAGGTCAAGA
Conceptual translation MEMRNTTPDFILLGLFNHTRAHQVLFMMLLATVLTSLFSNALMILLIHWDHRLHRPMYFL
LSQLSLMDMMLVSTTVPKMAADYLTGNKAISRAGCGVQIFFLPTLGGGECFLLAAMAYDR
YAAVCHPLRYPTLMSWQLCLRMTMSSWLLGAADGLLQAVATLSFPYCGAHEIDHFFCEAP
VLVRLACADTSVFENAMYICCVLMLLVPFSLILSSYGLILAAVLLMRSTEARKKAFATCS
SHVAVVGLFYGAGIFTYMRPKSHRSTNHDKVVSAFYTMFTPLLNPLIYSVRNSEVKEALK
RWLGTCVNLKHQQNEAHRSR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS T/C R/G 1000GP (YRI, YRI)
1 100 -100 SYN G/T T/T 1000GP (YRI)
1 248,295,415 248,295,415 NS C/G R/T 1000GP (CEU)
1 248,295,458 248,295,458 NS C/A A/S 1000GP (CEU, CHBJPT)
1 248,457,979 248,457,979 NS A/C L/R rs6667171 (DbSNP)
1 248,457,993 248,457,993 NS C/G K/N rs11204625 (DbSNP)
1 248,458,569 248,458,569 SYN G/T T/T rs35216356 (DbSNP)
1 248,458,571 248,458,571 NS A/T S/T rs12137982 (DbSNP)
1 248,458,573 248,458,573 NS A/G L/P rs34901845 (DbSNP)
1 248,458,575 248,458,575 SYN C/G L/L rs36100041 (DbSNP)
1 248,458,676 248,458,676 NS C/T V/M rs6678138 (DbSNP)
1 248,458,689 248,458,689 SYN A/G L/L rs6674940 (DbSNP)
1 248,458,717 248,458,717 NS C/G R/T rs12745228 (DbSNP)
1 248,458,736 248,458,736 NS A/G W/R rs28409263 (DbSNP)
1 248,458,760 248,458,760 NS A/C S/A rs12135684 (DbSNP)
1 248,458,766 248,458,766 NS C/T G/S rs41310573 (DbSNP)
1 248,458,796 248,458,796 NS C/G V/L rs41304145 (DbSNP)
1 248,458,876 248,458,876 Del(1) -/T rs11339452 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,319,780 248,490,372 CopyNumber Variation_31702 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R301L K296N R55T R55G W49R A41S S39G % Freq CORP
1 L K T R W A S 33.72 0.259
2 R K R R W A S 25.04 0.259
3 L K R R W A S 16.44 0.259
4 L N T R R S S 10.45 0.259
5 L N R R R S S 3.07 0.259
6 L K R G W A S 2.92 0.259
7 L N R R W A S 2.15 0.259
8 L K T R W S S 1.54 0.259
9 L N T R W S S 1.31 0.259
10 L N T R W A S 1.00 0.259
11 R K T R W A S 0.46 0.259
12 R K T R R S S 0.31 0.259
13 L K R R W S S 0.31 0.259
14 L K R R W S G 0.23 0.259
15 R N R R W A S 0.15 0.259
16 R K R R R S G 0.15 0.259
17 L N R R W S S 0.15 0.259
18 R K R R R S S 0.08 0.259
19 L K R R R A S 0.08 0.259
20 L K T R R S S 0.08 0.259
21 R K R R R A S 0.08 0.259
22 R N T R W A S 0.08 0.259
23 R K R G W A S 0.08 0.259
24 L K R R R S S 0.08 0.259
25 L K R R R S G 0.08 0.259

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2T12.aApr07-unspliced main_exon 3UTR chr1 248,294,616 248,294,619 -
CDS chr1 248,294,619 248,295,578 -