Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2T2 Olfactory Receptor

Gene Symbol OR2T21 (View this gene in GeneCards)
Family 2
Subfamily T
Pseudogene No
CORP pseudogene probability score 0.05 (functional)
Aliases OR1-43, HsOR1.5.41
External Ids HGNC: 14725   GeneBank: AF399479, BK004462, NM_001004136   
Build #39 labels OR2T2
Chromosomal location 1:248,452,798-248,453,769 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2T35 99.38% 322

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2T11 72% 311
Mouse Or2t35 83% 321
Rat Or2t35 86% 321
Cow OR2T11 74% 303
Orang OR2T2P 95% 317
Orang OR2T2BP 95% 284
Horse OR2T2C 81% 321
Chimp OR2T11 71% 311

Expression evidences

Source Accession
mRNA BC136962

Sequence information

Nucleotide sequence ATGGGCATGGAGGGTCTTCTCCAGAACTCCACTAACTTCGTCCTCACAGGCCTCATCACC
CATCCTGCCTTCCCCGGGCTTCTCTTTGCAATAGTCTTCTCCATCTTTGTGGTGGCTATA
ACAGCCAACTTGGTCATGATTCTGCTCATCCACATGGACTCCCGCCTCCACACACCCATG
TACTTCTTGCTCAGCCAGCTCTCCATCATGGATACCATCTACATCTGTATCACTGTCCCC
AAGATGCTCCAGGACCTCCTGTCCAAGGACAAGACCATTTCCTTCCTGGGCTGTGCAGTT
CAGATCTTCCTCTACCTGACCCTGATTGGAGGGGAATTCTTCCTGCTGGGTCTCATGGCC
TATGACCGCTATGTGGCTGTGTGCAACCCTCTACGGTACCCTCTCCTCATGAACCGCAGG
GTTTGCTTATTCATGGTGGTCGGCTCCTGGGTTGGTGGTTCCTTGGATGGGTTCATGCTG
ACTCCTGTCACTATGAGTTTCCCCTTCTGTAGATCCCGAGAGATCAATCACTTTTTCTGT
GAGATCCCAGCCGTGCTGAAGTTGTCTTGCACAGACACGTCACTCTATGAGACCCTGATG
TATGCCTGCTGCGTGCTGATGCTGCTTATCCCTCTATCTGTCATCTCTGTCTCCTACACG
CACATCCTCCTGACTGTCCACAGGATGAACTCTGCTGAGGGCCGGCGCAAAGCCTTTGCT
ACGTGTTCCTCCCACATTATGGTGGTGAGCGTTTTCTACGGGGCAGCCTTCTACACCAAC
GTGCTGCCCCACTCCTACCACACTCCAGAGAAAGATAAAGTGGTGTCTGCCTTCTACACC
ATCCTCACCCCCATGCTCAACCCACTCATCTACAGCTTGAGGAATAAAGATGTGGCTGCA
GCTCTGAGGAAAGTACTAGGGAGATGTGGTTCCTCCCAGAGCATCAGGGTGGCGACTGTG
ATCAGGAAGGGC
Conceptual translation MEGLLQNSTNFVLTGLITHPAFPGLLFAIVFSIFVVAITANLVMILLIHMDSRLHTPMYF
LLSQLSIMDTIYICITVPKMLQDLLSKDKTISFLGCAVQIFLYLTLIGGEFFLLGLMAYD
RYVAVCNPLRYPLLMNRRVCLFMVVGSWVGGSLDGFMLTPVTMSFPFCRSREINHFFCEI
PAVLKLSCTDTSLYETLMYACCVLMLLIPLSVISVSYTHILLTVHRMNSAEGRRKAFATC
SSHIMVVSVFYGAAFYTNVLPHSYHTPEKDKVVSAFYTILTPMLNPLIYSLRNKDVAAAL
RKVLGRCGSSQSIRVATVIRKG

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS C/T L/F 1000GP (YRI)
1 100 -100 SYN G/A Q/Q 1000GP (YRI)
1 248,453,100 248,453,100 SYN G/A Q/Q 1000GP (CHBJPT)
1 248,453,107 248,453,107 NS C/T L/F 1000GP (CEU, CHBJPT)
1 248,616,408 248,616,408 NS C/T L/F rs73147579 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,500,109 248,865,374 CopyNumber Variation_3340 (DGV)
1 248,522,680 249,158,239 CopyNumber Variation_8355 (DGV)
1 248,595,681 248,817,382 CopyNumber Variation_2359 (DGV)
1 248,604,260 248,635,197 CopyNumber Variation_71754 (DGV)
1 248,609,916 248,625,792 CopyNumber Variation_71757 (DGV)
1 248,610,257 248,646,763 CopyNumber Variation_6817 (DGV)
1 248,616,113 248,619,344 CopyNumber Variation_30466 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

% Freq CORP
1 89.37 0.132
2 10.34 0.132
3 0.29 0.132

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2T2.aApr07-unspliced main_exon CDS chr1 248,452,798 248,453,769 +
3UTR chr1 248,453,769 248,453,772 +